KEGG   Mycobacterium tuberculosis H37Rv: Rv2383cHelp
Entry
Rv2383c           CDS       T00015                                 

Gene name
mbtB
Definition
(RefSeq) phenyloxazoline synthase
  KO
K04788  
mycobactin phenyloxazoline synthetase
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2383c (mbtB)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2383c (mbtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
complement(2671593..2675837)
Genome map
AA seq 1414 aa AA seqDB search
MVHATACSEIIRAEVAELLGVRADALHPGANLVGQGLDSIRMMSLVGRWRRKGIAVDFAT
LAATPTIEAWSQLVSAGTGVAPTAVAAPGDAGLSQEGEPFPLAPMQHAMWVGRHDHQQLG
GVAGHLYVEFDGARVDPDRLRAAATRLALRHPMLRVQFLPDGTQRIPPAAGSRDFPISVA
DLRHVAPDVVDQRLAGIRDAKSHQQLDGAVFELALTLLPGERTRLHVDLDMQAADAMSYR
ILLADLAALYDGREPPALGYTYREYRQAIEAEETLPQPVRDADRDWWAQRIPQLPDPPAL
PTRAGGERDRRRSTRRWHWLDPQTRDALFARARARGITPAMTLAAAFANVLARWSASSRF
LLNLPLFSRQALHPDVDLLVGDFTSSLLLDVDLTGARTAAARAQAVQEALRSAAGHSAYP
GLSVLRDLSRHRGTQVLAPVVFTSALGLGDLFCPDVTEQFGTPGWIISQGPQVLLDAQVT
EFDGGVLVNWDVREGVFAPGVIDAMFTHQVDELLRLAAGDDAWDAPSPSALPAAQRAVRA
ALNGRTAAPSTEALHDGFFRQAQQQPDAPAVFASSGDLSYAQLRDQASAVAAALRAAGLR
VGDTVAVLGPKTGEQVAAVLGILAAGGVYLPIGVDQPRDRAERILATGSVNLALVCGPPC
QVRVPVPTLLLADVLAAAPAEFVPGPSDPTALAYVLFTSGSTGEPKGVEVAHDAAMNTVE
TFIRHFELGAADRWLALATLECDMSVLDIFAALRSGGAIVVVDEAQRRDPDAWARLIDTY
EVTALNFMPGWLDMLLEVGGGRLSSLRAVAVGGDWVRPDLARRLQVQAPSARFAGLGGAT
ETAVHATIFEVQDAANLPPDWASVPYGVPFPNNACRVVADSGDDCPDWVAGELWVSGRGI
ARGYRGRPELTAERFVEHDGRTWYRTGDLARYWHDGTLEFVGRADHRVKISGYRVELGEI
EAALQRLPGVHAAAATVLPGGSDVLAAAVCVDDAGVTAESIRQQLADLVPAHMIPRHVTL
LDRIPFTDSGKIDRAEVGALLAAEVERSGDRSAPYAAPRTVLQRALRRIVADILGRANDA
VGVHDDFFALGGDSVLATQVVAGIRRWLDSPSLMVADMFAARTIAALAQLLTGREANADR
LELVAEVYLEIANMTSADVMAALDPIEQPAQPAFKPWVKRFTGTDKPGAVLVFPHAGGAA
AAYRWLAKSLVANDVDTFVVQYPQRADRRSHPAADSIEALALELFEAGDWHLTAPLTLFG
HCMGAIVAFEFARLAERNGVPVRALWASSGQAPSTVAASGPLPTADRDVLADMVDLGGTD
PVLLEDEEFVELLVPAVKADYRALSGYSCPPDVRIRANIHAVGGNRDHRISREMLTSWET
HTSGRFTLSHFDGGHFYLNDHLDAVARMVSADVR
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcatgctacggcgtgctcggagatcattcgcgccgaggtcgcagagttgctcggt
gtccgcgccgatgctctgcaccccggcgccaacctcgttggtcagggcctggactcgatc
cggatgatgtcgctggtggggcgctggcgccggaagggcatcgccgtcgacttcgccaca
ctggccgccacacccacaatcgaggcctggtcccaactggtgtccgccggcaccggcgtc
gcgcccacggcagttgccgcaccaggggatgccgggttatcccaggaaggcgagcctttc
ccgctggcgccgatgcagcacgcgatgtgggtcggccgccacgaccaccaacagctcggc
ggggtagctgggcacctctacgtcgagttcgatggtgcccgggtcgatccggacaggctc
cgcgcggcggccacccggttggcgctgcggcacccgatgctgcgggtgcagttcttgccc
gacggcacccagcgcatcccgccggcggcgggatctcgcgactttcccatcagtgttgcc
gacctgcgtcacgtggccccggatgtcgtcgatcagcggttggcggggatccgcgacgcc
aaatcgcaccagcagctcgacggtgcggtattcgaacttgcgttgacgttattaccgggg
gagcgcacccgcctacatgtcgacctggacatgcaggccgctgacgcgatgagctaccgc
atcttgctggccgacctggcggccctctatgacggccgtgaaccgccggcactgggctac
acctaccgggaataccggcaggctatcgaggcggaggagacgctgccccaaccggttcgc
gacgccgaccgggactggtgggcgcagcgcatcccgcagctgccggatccgcccgcgctg
cctacccgggccggcggcgaacgcgaccggcgccgcagcacccggcgctggcactggcta
gacccgcagacccgcgacgcgttgttcgcccgagcccgggcccgcggcatcaccccggcg
atgacgctggccgcggcctttgccaacgtgctggcgcgttggtcagcgtcgtcgcggttc
ctgctgaacctgccgttgttcagtcgccaggccctgcatccagacgtcgacctgctggtc
ggtgacttcacctcctcgctgttgctcgacgtcgatctgaccggtgcgcgcacggcggcg
gcgcgggcgcaggcggtgcaggaagccctgcgcagcgccgcaggccacagtgcatacccc
gggctgtctgtgctgcgtgacctcagccgccaccgtggcacccaggtgctggcaccggtg
gtattcaccagcgcgctggggctcggcgaccttttctgcccggacgtcaccgagcaattc
ggcacacccggatggatcatttcgcaggggccccaggtgctgctcgacgcccaggtcacc
gagttcgacggcggtgtgctggtgaactgggatgtccgcgagggggtctttgcacccggc
gtcatcgacgccatgttcacccaccaggtcgacgaattgctccggttggccgccggggac
gacgcctgggatgcgccgagcccgtccgcgctacccgccgcgcaacgcgcggtgcgcgcg
gcgctgaacggtcgcaccgccgcccccagcaccgaggcgctgcacgacgggtttttccgc
caggcccaacagcagcccgacgcgccggcggtgttcgccagttccggcgacttgagctac
gcccaactgcgcgaccaggcatcggcggtggccgcggcgctgcgtgctgcgggcctacga
gtcggcgacaccgtcgcggtgctgggtccgaaaacgggcgaacaagtggcggctgtgctg
gggattttggccgccggcggggtctatctgccgatcggcgtcgaccagccccgcgaccgc
gcggagcgcatcctggcgaccggttcggtcaacttagcgctcgtttgcggcccgccatgc
caagtgcgggtgccggtcccgacgctgttgctggctgacgtgcttgccgccgcgccggca
gaattcgtgcccgggcctagcgatcccaccgcgctcgcctatgtgttgttcacctcgggc
tcaaccggggaacccaagggtgtcgaggtggcgcacgacgccgcgatgaacaccgtggag
accttcatccggcacttcgagctaggcgccgcagatcgctggcttgccctggcgacgctg
gagtgcgacatgtcggtgctggacatcttcgccgccctgcgctccggcggagcgatcgtg
gtggtcgacgaagcgcagcgccgcgatcccgacgcctgggcccggcttatcgacacttac
gaggtcacggcgttgaatttcatgccgggctggttggacatgctgctcgaagtcggcggg
ggccggctgtcgtcgctgcgagcggtggccgtcggcggcgactgggtgcgtcccgacctg
gcccgccgcctgcaggtgcaagcgccgagcgcacggttcgcggggttgggtggagccacc
gaaaccgcggtccacgcaaccattttcgaggtccaggacgcggccaatctgccaccggac
tgggcctcggtgccatacggcgtcccgtttcccaacaacgcctgccgggtagtggccgac
agcggcgacgactgccccgattgggtggccggtgagttgtgggtgtccggtcgcggaatc
gcccggggttaccgtggccgtcccgagctgaccgcggagcgcttcgtcgagcatgacggc
cgcacctggtatcgcaccggtgatctggcccgctactggcacgacggcaccctggagttc
gtcggccgtgccgatcaccgcgtcaagatcagcgggtaccgcgtcgaactcggcgagatc
gaagccgcgctgcagcgcttgcccggtgtgcacgcggcggcggccaccgtgcttcctggc
gggtccgatgtgctggccgcggcggtctgcgtcgacgatgccggcgtgaccgcggagtcg
attcgacagcagctcgccgatctggtgcccgcgcacatgattccgcgccacgtcacgctg
ctagaccgcatcccctttaccgacagcggcaagatcgaccgcgcggaggttggcgccctg
cttgccgccgaggtcgagcggtctggcgacagatcggcaccctatgcggcgccgcgaacg
gtgcttcagcgggcactgcgccgcatcgtcgcggacatcctgggccgtgccaacgatgcc
gtgggcgtgcacgacgacttctttgccctgggcggcgattccgtgcttgcgacccaggtc
gtcgccggtatccggcggtggctggattcgccgagcctgatggtcgccgacatgtttgcc
gccaggaccattgccgcgttggcccagttgctcaccggtcgggaagccaacgccgaccga
ctcgaactggtcgccgaggtgtacttagaaatcgcgaatatgacaagtgccgacgtgatg
gcggcgctcgatccgatcgagcagcccgcacagccagccttcaaaccgtgggtgaagcgg
ttcaccggtactgacaagcccggcgcggtgctggtgtttccacacgccggcggcgctgcc
gcggcttaccggtggttggcaaaatcgttagtggccaacgacgttgacacgttcgtggtg
cagtacccgcagcgggctgaccggcgcagccacccggcggcagacagcatcgaggcgctg
gcgctcgagctgttcgaggcgggcgactggcacctgacggctccgctgacgctgttcggc
cattgcatgggtgcgatagtggccttcgagttcgctcgcctcgccgagcgcaatggcgtg
ccggtacgtgcactgtgggcttcctccggtcaggctccgtcgacggtggccgcgtccgga
ccgttgccgaccgccgaccgtgacgtcctggccgacatggtggatcttggcggcaccgat
cccgtgctgctcgaggacgaggaattcgttgaactgctggtgccggcggtcaaggccgac
tatcgggccctcagcggctattcatgtccacccgacgtgcgcatccgcgccaacatccac
gcggtcggcggcaaccgcgaccaccgcatcagccgggagatgttgaccagttgggagact
cacacctccggtcgcttcacgctgtcgcactttgatggtggtcacttctatctcaacgat
cacctcgacgccgtggcccggatggtgagtgccgatgtccgataa

DBGET integrated database retrieval system