KEGG   Mycobacterium tuberculosis H37Rv: Rv2950cHelp
Entry
Rv2950c           CDS       T00015                                 

Gene name
fadD29
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD29
  KO
K21059  
4-hydroxyphenylalkanoate adenylyltransferase [EC:2.7.7.94]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.94  4-hydroxyphenylalkanoate adenylyltransferase
     Rv2950c (fadD29)
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rv2950c (fadD29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
complement(3300596..3302455)
Genome map
AA seq 619 aa AA seqDB search
MKTNSSFHAAGEVATQPAWGTGEQAAQPLNGSTSRFAMSESSLADLLQKAASQYPNRAAY
KFIDYDTDPAGFTETVTWWQVHRRAMIVAEELWIYASSGDRVAILAPQGLEYIIAFMGVL
QAGLIAVPLPVPQFGIHDERISSALRDSAPSIILTTSSVIDEVTTYAPHACAAQGQSAPI
VVAVDALDLSSSRALDPTRFERPSTAYLQYTSGSTRAPAGVVLSHKNVITNCVQLMSDYI
GDSEKVPSTPVSWLPFYHDMGLMLGIILPMINQDTAVLMSPMAFLQRPARWMQLLAKHRA
QISSAPNFGFELAVRRTSDDDMAGLDLGHVRTIVTGAERVNVATLRRFTERFAPFNLSET
AIRPSYGLAEATVYVATAGPGRAPKSVCFDYQQLSVGQAKRAENGSEGANLVSYGAPRAS
TVRIVDPETRMENPAGTVGEIWVQGDNVGLGYWRNPQQTEATFRARLVTPSPGTSEGPWL
RTGDLGVIFEGELFITGRIKELLVVDGANHYPEDIEATIQEITGGRVVAIAVPDDRTEKL
VTIIELMKRGRTDEEEKNRLRTVKREVASAISRSHRLRVADVVMVAPGSIPVTTSGKVRR
SASVERYLHHEFSRLDAMA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaactcgtcatttcatgccgcgggcgaggtggcgacacaaccggcatggggc
accggtgagcaagcggcacaaccgctgaacgggagcacatcgcgattcgctatgagcgag
tcgtcgctcgctgatctcctacagaaggcggcgagccagtaccccaatcgcgcggcgtac
aagttcattgactatgacacggatccggctggcttcaccgaaaccgtgacgtggtggcaa
gtccaccggcgagcgatgatcgtggcagaggagctctggatatacgcgtcaagcggtgat
cgggtcgcgatattggccccgcagggccttgaatacatcatcgcctttatgggtgtgctg
caggctggtctcattgcggttcctcttccggtgccacaattcggcattcacgacgaacga
atatcttcggcattacgagactctgcgccgtccattattcttacgacctcgtcggttatt
gacgaggtcacgacatatgcgccacatgcgtgcgccgcacagggccagtccgcgcccatc
gtcgtggctgtggacgctctggacttgagctcatccagagcgctcgatccgactcggttc
gagcgtccgagcacagcatatctacagtacacatccggttcgacccgcgcgccggccggt
gttgtcctctcgcacaagaatgtcatcaccaactgcgtacagctaatgtccgattacatc
ggggattcggaaaaggttccgtcaactcccgtatcgtggctgccgttctatcacgacatg
gggttgatgctgggcatcattctcccgatgatcaatcaagacaccgcggtgttgatgagt
cccatggcattcttgcagcggccggcccgttggatgcaattattagccaaacaccgcgca
cagatttccagcgcaccgaatttcggtttcgaattggcggtacgcagaacatccgacgac
gatatggctggacttgacctcgggcatgtgcggacgatcgtcaccggcgccgaacgagta
aacgtcgcgacgctgcggcgcttcaccgagcggttcgccccgttcaacctcagcgagacg
gcaatccggccgtcatatgggctcgcggaggcgacggtgtacgtggcgaccgccggaccg
ggacgcgcgccgaagagtgtttgctttgactaccagcagctgtcggtcggtcaggcgaag
cgtgccgagaacggcagcgagggagccaacctggtgagttatggagctccccgggcgtca
accgtgcggatcgtcgaccccgaaaccaggatggagaatcccgcggggacggttggcgaa
atctgggtgcagggagacaacgtcggcttgggctactggcgcaacccgcagcagacggag
gcgacgttccgcgcgcggctcgtcactccctcgcccgggacttcggaaggtccgtggctg
cggaccggagacctcggcgtcattttcgagggcgaactgttcatcacgggtcgcatcaag
gagctgttggtggtggatggggccaaccactatccggaagacatcgaggcgacgatccag
gaaatcaccggcggccgggttgtggcgattgcggtgcccgatgaccgtactgaaaagctg
gtaaccattatcgaactcatgaagcggggtcgcacagatgaggaggaaaagaatcgactc
cgcaccgtcaaacgtgaagtcgcctccgcgatatccaggtcacatcgtctgcgcgtcgcg
gatgtcgttatggtggcgccgggttctattccggtcaccaccagcggtaaggttcggcgt
tcggccagcgttgagcgttacctacatcacgaattcagccgcctagatgctatggcataa

DBGET integrated database retrieval system