KEGG   Mycobacterium tuberculosis H37Rv: Rv3032Help
Entry
Rv3032            CDS       T00015                                 

Definition
(RefSeq) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00500  Starch and sucrose metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv3032
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Rv3032
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Storage polysaccharide
   Rv3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 888185
NCBI-ProteinID: NP_217548
TubercuList: Rv3032
UniProt: P9WMY9 I6YF03
LinkDB All DBs
Position
3391534..3392778
Genome map
AA seq 414 aa AA seqDB search
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctcatggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgc
cacgtgcatcatctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcc
cggtgtccgtcgggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggg
gtccgggtgattgcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatg
gcctggaccctggcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaactt
ggcaccgaccgctcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccat
ccggccatcgcccttgcccagttctatgacgtgccaatggtttccacgattcatgcaacg
gaggccggtcgacattccggctgggtctccggagctctcagccgtcaggtgcacgcggtc
gagtcgtggctggtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgac
gagatcaccgagctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcatt
gacgcggcgcgctggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctc
tatgtggggcggctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcgg
ctcaggcgcactcacccaggcaccacactgaccatcgccggcgaaggcacccagcaggat
tggttgatcgatcaggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacac
ctcgaccacaccgagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagc
cactacgaaccgtttgggctggtggcactggaggccgccgcggccggcaccccgctggtg
acgtccaacatcggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgt
gcaccccgcgacgtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggcc
gccgcgcagcggcgcgcacgagccgcccggcaacggctcacctccgacttcgactggcag
acggtggccaccgcgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccg
cagccccggttgcccatcgtcgagcacgctcttcccgatcggtag

DBGET integrated database retrieval system