KEGG   Mycobacterium tuberculosis H37Rv: Rv3561Help
Entry
Rv3561            CDS       T00015                                 

Gene name
fadD3
Definition
(RefSeq) fatty-acid--CoA ligase FadD3
  KO
K18687  
HIP---CoA ligase [EC:6.2.1.41]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Steroid degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Rv3561 (fadD3)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.41  3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoate---CoA ligase
     Rv3561 (fadD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
LinkDB All DBs
Position
4001637..4003160
Genome map
AA seq 507 aa AA seqDB search
MINDLRTVPAALDRLVRQLPDHTALIAEDRRFTSTELRDAVYGAAAALIALGVEPADRVA
IWSPNTWHWVVACLAIHHAGAAVVPLNTRYTATEATDILDRAGAPVLFAAGLFLGADRAA
GLDRAALPALRHVVRVPVEADDGTWDEFIATGAGALDAVAARAAAVAPQDVSDILFTSGT
TGRSKGVLCAHRQSLSASASWAANGKITSDDRYLCINPFFHNFGYKAGILACLQTGATLI
PHVTFDPLHALRAIERHRITVLPGPPTIYQSLLDHPARKDFDLSSLRFAVTGAATVPVVL
VERMQSELDIDIVLTAYGLTEANGMGTMCRPEDDAVTVATTCGRPFADFELRIADDGEVL
LRGPNVMVGYLDDTEATAAAIDADGWLHTGDIGAVDQAGNLRITDRLKDMYICGGFNVYP
AEVEQVLARMDGVADAAVIGVPDQRLGEVGRAFVVARPGTGLDEASVIAYTREHLANFKT
PRSVRFVDVLPRNAAGKVSKPQLRELG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgataaacgatctgcgcaccgtgcccgcggcgctggatcgtctcgtgcgccagctaccc
gaccacacggcgttgatcgccgaggaccggcgtttcacgtcgaccgagctgcgcgacgcg
gtctacggcgccgcggcggcgctgatcgccctcggtgtcgaacccgcagaccgggtggcc
atctggtcgccgaacacctggcactgggtggtggcctgcctggcgatccaccacgccggc
gccgcggtggtgccgttgaacacccgctacaccgccacagaagccaccgacatcttggac
cgagccggcgcgccggtgctgttcgcggcgggcctcttcctgggcgccgaccgggcggcc
ggcctggaccgggccgcgctgcccgcgttgcggcacgtcgtgcgggtgccggtcgaagcc
gacgacgggacctgggacgagttcatcgccacgggtgccggggccctggatgccgtcgca
gcccgtgccgccgccgtcgcaccccaggacgtcagcgacatcctgttcacctccggcacc
accggccgcagcaaaggcgtgctgtgcgcgcaccggcagtcgctgtcggcctcggcatcc
tgggccgccaacgggaagatcaccagcgacgaccgctacctgtgcatcaacccgttcttc
cacaacttcggctacaaggccggcatcctggcctgcctgcagaccggtgccacgctgatc
ccgcacgtgacgttcgatccgctgcacgcgctgcgggccatcgagcgccaccgcatcacc
gtgttgccgggccctccgaccatctaccagagcctgctggatcacccggcccgcaaagac
ttcgacctgagctcgctgcggttcgcggtcaccggtgcggccaccgtgccggtggtgctg
gtggagcgcatgcagtccgaacttgacatcgacatcgtgctgaccgcctacgggttgacc
gaggccaacgggatggggacgatgtgccgccccgaggacgacgcggtgaccgttgcgacg
acgtgcgggcggccgttcgccgactttgagttgcgcattgcggacgacggggaagtgttg
ctgcgcgggccgaacgtcatggtgggctatctggacgacacggaggcgaccgcggccgcc
atcgacgccgacggctggctgcacaccggcgacatcggtgccgtcgaccaggcgggcaac
ctgcgcatcaccgaccgcctgaaggacatgtacatctgcggcggattcaacgtctatccc
gccgaggtcgagcaggtgctggcccggatggacggcgtcgcggacgccgcggtgatcggc
gttcccgaccagcggctgggcgaggtcggccgggcgttcgtggtggcgcgccccggcacg
ggcctcgacgaggcatcggtgatcgcttacacccgtgaacatttggcgaacttcaagaca
ccccggtcggtgcggttcgtcgacgtactgccgcgcaacgccgccggtaaggtgagcaaa
ccacaactgcgagagctgggctag

DBGET integrated database retrieval system