KEGG   Mycobacterium tuberculosis CAS/NITR204: J113_20780Help
Entry
J113_20780        CDS       T02652                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtuc  Mycobacterium tuberculosis CAS/NITR204
Pathway
mtuc00473  D-Alanine metabolism
mtuc00550  Peptidoglycan biosynthesis
mtuc01100  Metabolic pathways
mtuc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtuc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    J113_20780 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    J113_20780 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    J113_20780 (ddl)
Enzymes [BR:mtuc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     J113_20780 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:mtuc01011]
 Precursor biosynthesis
  Amino acid ligase
   J113_20780 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AGL28422
UniProt: R4MLT2
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(3325537..3326604)
Genome map
AA seq 355 aa AA seqDB search
MFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQ
VKSGSGTELALPADPRRGGQLVSLPPGAGEAGVDVVFGLHGPYGEDGTIQGLLELAGVPY
VGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLHRQECERLGLPVFVKPARG
GSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELECGVLEMPDGTLEASTLGEI
RVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQLAIRAFAAIDCRGLARVD
FFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIETALARGVGLH
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggcgggcgcagcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctg
cgcaacctggactcgcggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcg
tgggtgctcaccgacgccaaccccgacgccctgacgatcaccaaccgggagcttcctcag
gtcaaatcaggatcgggcaccgagctggcgctgccggccgatccgcggcgtggtggccag
ttggtgtcgctgccgcccggggccggtgaggctggcgtcgacgtggtgttcggtctgcac
ggcccgtacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctac
gtgggcgccggtgtgctggccagtgccgtcggcatggacaaggagttcaccaagaagctg
ctcgccgccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccgcggtcgaca
ctgcaccgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccgaggc
ggctcgtcgatcggtgttagccgggtgtcgagttgggatcaactgcccgccgcggtcgcg
cgggcccgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctg
gaatgcggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatc
cgggtggccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctc
gacgacgcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgatt
cgtcagctggcgatccgggcgttcgcggctatcgactgccggggtctggccagggtggac
ttcttcctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcacc
acgatctcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgaccctgctg
gcgacgatgatcgagacggcattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system