KEGG   Mucilaginibacter sp. BJC16-A31: MuYL_4042Help
Entry
MuYL_4042         CDS       T05010                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
muc  Mucilaginibacter sp. BJC16-A31
Pathway
muc00020  Citrate cycle (TCA cycle)
muc00310  Lysine degradation
muc00380  Tryptophan metabolism
muc01100  Metabolic pathways
muc01110  Biosynthesis of secondary metabolites
muc01120  Microbial metabolism in diverse environments
muc01130  Biosynthesis of antibiotics
muc01200  Carbon metabolism
Module
muc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
muc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:muc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MuYL_4042
  Amino acid metabolism
   00310 Lysine degradation
    MuYL_4042
   00380 Tryptophan metabolism
    MuYL_4042
Enzymes [BR:muc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MuYL_4042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASU35927
UniProt: A0A223P1G2
LinkDB All DBs
Position
complement(4288207..4291014)
Genome map
AA seq 935 aa AA seqDB search
MDRLNYINSGNAAYINSLYEAYKQDPESVDFGWQKFFEGFDFGKETPTPAAAVTPETPEH
FLKEINVLNMIDGYRTRGHLFTKTNPVRERRKYFPGKELETFGLSDADLDTVFTSGVEVG
LGAATLRDIRQLLEDTYCQSIGAEYRYIRNPIKLKWFEDRMESKRNTPSFTVDEKKLMLD
KLNEAVVFENFLGTKFLGQKRFSLEGAESLIPALDMVIQNGSELGIQEFIVGMAHRGRLN
VLTNIMEKPYKEVFSEFEGKNFDEDTPFGGDVKYHLGYSTDVVTKGGKKVHLSLCPNPSH
LEAVDPVVEGLTRSKIDFKYNGDHSKIAPILIHGDASVAGQGIVYEVLQMEKLDGYRTGG
TIHIVINNQIGFTTNFKDARSSTYCTDVAKTVLSPVFHVNGDDVEALAYVVNLAMEYRQV
FHEDVFIDILCYRRYGHNEADEPKFTQPLLYKAIEAHPNPLEIYKQKLQKEGSIDASLAL
EMEKKFRAELQVKLDESKAEDKFTETVHMFEGAWQGMHLATTREFFTPIDTAVPENELLE
IGKKITDLPKGKEFFKKIEKLFDERRKMVDSTHVFDWAMGELLAYGSLLKDGHPVRLSGE
DVKRGTFSHRHAVLTLVDSEDEFIPLETINSEAKLSIFNSLLSEYGVLGFEYGYALANPN
ALTIWEAQFGDFFNGAQIIVDQYIASAETKWQRGNGLVMLLPHGYEGQGPEHSSARVERF
LELCADSNIQVANCTTPANFFHILRRQMLRDFRKPLIIFTPKSLLRSPKCVSKLEEFTGG
KFHELIDDTYADPKKVKRVLLCTGKIYYDLLEKQQVDKRKDVAIVRVEQLYPTPVVQILK
VKAKYARATEFIWVQEEPENMGAWPYICRKFHNDNVINLNVISRHEGSSTATGFAKQHAA
QQLHIVSKAFEAPAGKQVKAAVKATAEKMANVGVD
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcctcaattatataaacagcgggaacgctgcatacattaattccctttacgaa
gcatataaacaagacccggaatctgttgactttggctggcagaagttttttgaaggattt
gactttggtaaggaaacaccaacacctgctgctgctgtaacccccgaaactcccgaacat
ttcctaaaggaaattaatgtgcttaacatgatagatggttaccgtacacgcggccattta
tttacaaaaactaacccggtacgcgaaaggcgcaagtactttcccggtaaagaattggaa
actttcgggcttagcgatgctgacctggataccgtttttacttcaggtgttgaagttggc
cttggtgcagctaccctgcgcgatatccgccagttactggaagatacctactgccagtct
ataggtgccgagtaccgttacatccgtaatcctataaaactgaaatggtttgaggacagg
atggaaagcaaacgtaatacgccgtcgtttacagtagacgaaaaaaagctgatgctggat
aagctgaacgaggcggttgtttttgaaaactttttaggaacaaaatttctggggcagaaa
cgattttcgcttgaaggtgctgaatcattgatcccggcattggatatggtgatccagaac
ggatcagagcttggtatccaggaattcattgtaggcatggctcaccgcggtaggcttaac
gtacttaccaacataatggagaagccttacaaagaggttttctcggaatttgaagggaag
aactttgacgaggataccccttttggcggcgacgttaaatatcacctgggctactcaacg
gatgtggtaaccaaaggtggtaaaaaggtgcatttgagcctttgccccaacccgtcgcac
ctggaagcggttgatccggttgttgaaggcctaacccgctcaaaaattgactttaagtac
aatggcgaccattcaaaaatagcgccgatattgattcatggcgatgcttcggttgccgga
cagggcattgtttacgaagtactacaaatggaaaaactggatggctaccgcaccggcgga
actatccatatagtgatcaataaccagattggttttaccaccaattttaaagatgcccgc
tcaagtacttattgtaccgacgtggctaaaacagtgctttcgccggtgtttcacgtaaat
ggtgatgatgttgaagcactggcatatgttgtaaacctggctatggagtaccgccaggta
ttccacgaagacgtgtttattgatattttatgctaccgcagatacgggcataacgaggct
gatgagccaaaattcacccagcctttattatacaaggctattgaagcacatccaaacccg
ctggagatctacaaacaaaaattgcagaaagaaggcagcattgatgccagcctggctttg
gaaatggaaaagaaattccgtgccgagctgcaggttaagctggatgaatcaaaggccgaa
gataagtttaccgaaactgtacatatgtttgaaggtgcctggcagggtatgcacttagct
accaccagggagttctttacacctatagatactgcggttcctgaaaatgaattgctggaa
ataggaaagaaaatcactgacctgccaaaaggaaaagagttctttaaaaagatagaaaag
ctttttgacgagcgccgcaaaatggtggacagtacccatgtttttgactgggccatgggc
gagttgctggcttatggtagtttattaaaagacggacatccggttaggttaagcggagag
gacgtgaaaaggggaactttttcacaccgccacgcagtattaacgctggttgattcggaa
gatgaatttataccgcttgaaaccatcaacagcgaagcaaaacttagtattttcaactca
ctgctttcggaatatggggtattgggttttgaatacgggtatgctttggctaaccctaat
gctttaacaatatgggaagcacagtttggcgactttttcaatggcgcgcaaattattgtt
gaccagtatatagccagcgccgaaacaaaatggcagcgtggtaacggcctggtaatgtta
ttgccgcacggttacgaagggcagggcccggaacattcatcggcacgtgttgaacgtttt
cttgagctttgtgccgatagcaacatccaggtagctaactgtactacgcctgcaaatttc
ttccatatcctgagaaggcaaatgctgagggatttccgcaagccgctgatcatatttacg
ccaaaaagtttgttacgcagccctaagtgcgtgtcaaaactggaagagtttaccggtggt
aagttccatgaattgattgacgatacttatgctgatcctaaaaaagtaaagcgtgtactg
ctttgtaccggtaaaatatattacgatctgcttgaaaagcaacaggtggacaaacgcaag
gacgtagctattgtgagggtggagcaattgtatccaaccccggttgttcagatccttaag
gtaaaggctaaatatgccagggccactgagtttatatgggtacaggaagaaccggagaat
atgggcgcatggccatatatttgccgcaagttccataacgataacgtgattaaccttaat
gtaatttcgaggcatgagggtagcagtactgcaaccggttttgccaaacaacatgctgcg
cagcagttacatattgtttcaaaggcatttgaagcgccagcaggcaagcaagtaaaggca
gcagtaaaagcaacggccgaaaaaatggccaatgttggagtagattaa

DBGET integrated database retrieval system