KEGG   Mycobacterium ulcerans: MUL_1598Help
Entry
MUL_1598          CDS       T00435                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase PykA
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_1598 (pykA)
   01230 Biosynthesis of amino acids
    MUL_1598 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_1598 (pykA)
   00620 Pyruvate metabolism
    MUL_1598 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    MUL_1598 (pykA)
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     MUL_1598 (pykA)
Exosome [BR:mul04147]
 Exosomal proteins
  Proteins found in most exosomes
   MUL_1598 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
1731548..1732966
Genome map
AA seq 472 aa AA seqDB search
MTRRGKIVCTLGPATQQDDLVKELVEAGMDVARMNFSHGDYADHEAAYERVRAASDATGR
AVGVLADLQGPKIRLGRFADGPTYWADGDTVRITVEECEGCRDRVSTTYKRLAQDAVAGD
RVLVDDGKVGLIVDHIDGNDVVCTVVEGGPVSNNKGISLPGMNVSAPALSEKDIDDLTFA
LNLGVDMVALSFVRSPSDVELVHEVMDRIGRRVPVIAKLEKPEAIDNLEAIVLAFDAVMV
ARGDLGVELPLEEVPLVQKRAIQIARENAKPVIVATQMLDSMIENSRPTRAEASDVANAV
LDGADALMLSGETSVGKYPLAAVRTMSRIVCAVEENSTAAPPLTHVPRTKRGVISYAARD
IGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTAWPEVRSQLAMTWGTETFIVPEMD
STDGMIRQVDKSLLELGRYKRGDLVVIVAGAPPGTVGSTNLIHVHRIGEDDV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgactagacgcggaaagatcgtctgcaccctcgggccggctacgcaacaggacgacttg
gtcaaagagctggtcgaagccggaatggacgtcgcccgaatgaacttcagccacggcgac
tacgcggatcacgaagccgcatatgaacgcgtgcgtgctgcctctgacgccacggggcgt
gcggtcggcgtgctcgccgatctgcaaggcccgaagatcaggttgggccgcttcgctgat
gggccgacctattgggctgacggggacacggtccggatcacggtcgaggagtgtgaaggg
tgccgtgaccgggtatccaccacctacaagaggctggcccaggatgcggtagccggtgac
cgagtgctcgttgatgacggcaaggtcggattgatcgtcgatcacatcgacggcaacgac
gtggtctgcacagtcgtagaaggcggcccggtcagcaacaacaagggaatctccctgccg
gggatgaatgtatctgcgccggcgctatcggagaaagacatcgacgacctcacgttcgcg
ctcaacctgggtgtcgacatggtcgcgctgtccttcgtgcggtcgccttcggacgtggaa
ctcgtgcatgaggtgatggaccggatcggccggcgagttccggtgatcgcgaagctggaa
aagcccgaagcgatcgacaatctcgaagccatcgtgttggcattcgacgccgtcatggtg
gcccgcggcgacctgggggtagagctgccgctggaagaggtcccgctggtacagaagcgg
gccatccagatcgcccgggagaacgccaaaccggtgatcgtggcgacccagatgctcgac
tcgatgatcgagaactcgcggcccacccgtgccgaggcctctgacgtcgccaacgccgtg
cttgacggcgccgatgccctgatgctgtccggtgagacctcggtgggcaagtacccactt
gctgcggtccggacgatgtcgcgcatcgtctgcgcggttgaagagaactcgacggcggcc
ccgccgttgacccatgtgccgcgcaccaagcggggagtgatctcctatgcggcccgcgac
atcggtgaacgactcgacgccaaggcgttggtcgccttcactcagtccggcgataccgtg
cgacggcttgctcggctgcataccccattgccgctgctggccttcaccgcttggcccgag
gtgcgcagtcagctcgcgatgacctggggcaccgagactttcatcgtcccggagatggac
tcgactgacggcatgattcggcaggtcgacaaatcgctgctagaactcggccgctacaag
cgtggtgatctggtggtcatcgtcgcgggtgcaccgccggggaccgtgggttcgaccaat
ctgattcacgtgcaccggatcggtgaggacgacgtctaa

DBGET integrated database retrieval system