KEGG   Mucilaginibacter sp. PAMC 26640: A0256_19150Help
Entry
A0256_19150       CDS       T04335                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mup  Mucilaginibacter sp. PAMC 26640
Pathway
mup00620  Pyruvate metabolism
mup00680  Methane metabolism
mup01100  Metabolic pathways
mup01120  Microbial metabolism in diverse environments
mup01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mup00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A0256_19150
  Energy metabolism
   00680 Methane metabolism
    A0256_19150
Enzymes [BR:mup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A0256_19150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMR33385
UniProt: A0A142HWX7
LinkDB All DBs
Position
complement(4419497..4422070)
Genome map
AA seq 857 aa AA seqDB search
MPTNQRLSQREATFNQEVVTRFELYNSLFQTLPFYQVKDTGILLPFFSSHCDKGAVSHSS
PKDIIESFFQNYVPGIEHREQINRLFRFIQYIERQVVLFDAIEDSSFGTVGRTDDTGPLQ
SMVQQATSNEDARKQISKQLEDFSLRLVLTAHPTQFYPGTILGIMNDLIEALKSNDIPEI
NALLQQLGKTPFFNKTSPTPVDEAVSLVWFLENIFYHALSGIQSKLEEEFEMDGAHQVLE
LGFWPGGDRDGNPNVTTESTREVSALLRKHIFRCYYRDFRVLKRRITFRGFADNLMKLEK
LLYDNAFNEQESPKDLQPEMLAILKSMRETLVTSHDSLFVDIVESMIQKVNLFGSYFATL
DIRQDSRVLRSVFEYGTKKIYTGVPKGYADMDEAAKLKTLPFTEADFMCPADADDMTRDT
LDTIRLMQQIQHSNGVKGCQRFIISNCQQASDILQLIDLFLWSGWKKDKLTVDFMPLFET
VNDLKHAADVMETLYKHPFYKKHLKSRGNRQTIMLGFSDSTKDGGYLMANWSIYKAKVEL
TAMARKYDIDLAFFDGRGGPPARGGGKTHRFYASMGKEIANEHIELTIQGQTVSSQYGSI
ETARFNTEQLINAGIISALHPNHKDLLDENHKALIAEMAGASHELFLALREHPLFVEYLE
TYSPLKLLSQINISSRPTKRNASAKLKLEDLRAISFVTSWSQLKQSIPGFYGVGTALKKM
KDGGTWEQVKELYQNSGFFKTMLDNCMMSMSKSDFRVTAYLEQDPKFGAFWKGLKDEFEL
TKSLLLELTGTTMLMEESPVERRSIAIREKIVLPLVIIQHYALQCLNNTQDEELIGIYNK
LVIRTVYGIVNAGRNLA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaatcaaaggcttagccaaagagaagcaacttttaatcaggaagttgtaacc
cgttttgagttgtacaacagtttgttccaaacactgcctttttaccaggtaaaggatact
ggtatcctcttgcctttctttagttcgcattgcgataagggcgcagttagtcattcttca
ccaaaggacatcattgagtctttttttcagaattatgtgccggggatagagcaccgggag
caaatcaatcgtttatttaggtttattcaatatattgaacgccaggtagttttatttgat
gccattgaagattcttcatttggcaccgttggccgtacagacgataccgggccgttacaa
agcatggtacagcaggcaacctccaacgaggatgcccgtaagcagatcagcaaacagctg
gaagatttttcgttaaggctggtgcttacagcgcaccctactcagttttacccaggcact
atcctgggtatcatgaatgatttgatagaggcgctgaaaagcaatgacattcctgaaatt
aacgccttgttgcaacaactaggtaaaacgcctttctttaataaaacctcaccaacgcct
gttgatgaggccgttagcttggtttggtttttagagaacatattttaccatgcactttcg
ggcattcaatcaaaactggaagaagaatttgagatggatggggcccatcaggtgctggaa
cttggcttttggccgggcggcgacagggatggtaaccctaacgtaacgacagaatctacc
cgcgaggtatcggctctgttgcgtaaacatatattccgctgctattaccgcgactttagg
gtattgaaacgccggatcactttccgtggttttgcggataacctgatgaagcttgaaaaa
ctgctttacgataatgcttttaacgagcaggaaagccctaaggatcttcagccggagatg
ctggccattcttaaatcgatgcgcgaaaccttggtaaccagtcacgatagtctttttgtt
gatatcgtggaaagcatgattcaaaaagtcaacttgtttggttcttatttcgccactttg
gatatcaggcaggatagccgcgttttacgaagcgtttttgagtacgggaccaaaaagatt
tatacaggtgtacctaagggatatgctgatatggacgaggctgcaaagcttaaaactttg
ccatttaccgaagccgatttcatgtgcccggcagacgctgatgacatgacccgcgataca
ttggatacgatcaggctgatgcaacaaattcagcatagtaacggggtgaagggctgccag
cgatttattatcagtaactgccagcaggcttctgatatattacaattgatcgatcttttc
ctttggagcggctggaaaaaggataagctgacggttgattttatgccgctgtttgaaacc
gttaatgatttgaaacatgcagcggatgttatggagacgttatacaagcatccgttttat
aaaaagcatttaaaaagcaggggtaaccgtcaaactataatgcttggttttagcgatagc
acgaaagatggtggttacctaatggccaattggagtatttataaagccaaggtagagctt
acagcaatggcccgcaaatatgatattgatctcgctttttttgacggcaggggtgggcca
ccggcccgaggcggcggtaaaacccaccgattctatgcatctatgggcaaagaaattgct
aacgaacacattgagctgactatacaagggcaaaccgtaagttctcaatatgggtctata
gaaacagcgaggttcaataccgagcagttgatcaatgccggaattatatccgccttgcat
cctaatcataaagatttgctggacgagaaccataaggcattaattgccgaaatggccggt
gccagccatgagctttttcttgcgctgcgcgagcatccgcttttcgtagaatacctggaa
acgtacagtccgttaaagttgttgtcgcagatcaatattagcagtcgcccaaccaagcgc
aatgcatcagccaagcttaagctggaagatttgcgtgccatcagttttgttacctcgtgg
agccagttaaaacaaagtattcctggtttttacggtgttggtaccgcgctgaagaaaatg
aaagacggtggcacctgggagcaggttaaagaactttaccagaattctggtttctttaaa
accatgctggataactgtatgatgtctatgtcaaaatcggatttcagggtaacagcctac
ctggaacaggatcctaagttcggagctttctggaaaggccttaaagacgagtttgaactg
acaaaatcacttttacttgaattgacaggtactacgatgttaatggaagaatctccggtt
gagcgccgatcgatagccattcgcgaaaagatagttttgccactggtgattattcagcat
tatgctttacagtgcctaaataatacgcaagacgaggagttgatcggcatatataataaa
ctggtaattcgtacggtatatggcatcgttaatgccgggcgaaacctggcgtag

DBGET integrated database retrieval system