KEGG   Musa acuminata (wild Malaysian banana): 103969434Help
Entry
103969434         CDS       T03447                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
Enzymes [BR:mus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103969434
Chromosome [BR:mus03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     103969434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
10
AA seq 428 aa AA seqDB search
MAASGSPVSALATSLRCLAFELLRVFAAPSLRIQIFSGLTTRNILLFPPSLSSLSLSQIS
PFWFVRSFTPASAMAASSSSPEAAPTGPADAISRDRILSSNLYFDVPPSKVPVIYSSSYD
IAFFGIEKLHPFDSSKWGRICQFLIKEGFLDKKQTVEPLEASKDDLLVVHSESYLSSLKS
SLNVAIIIEVPPVSLLPNCLVQNKVLYPFRKQVGGSILAAKLAKERGWAINIGGGFHHCS
AEKGGGFCAYADISLCIQFAFVLLNISRVMIIDLDAHQGNGHEIDFSNDRRVYILDMYNA
GIYPFDFEAKRYIDQKVELASGTKTKEYLDKLDEALKVARNNFNPELVVYNAGTDILDGD
PLGRLKISPDGVMTRDEKVFRFAREKNIPLLMLTSGGYMKSSARVIADSIINLSKKNLIA
LDSPLGRK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgagcggctcgcctgtatcagcactggccacatctcttcgctgtctcgccttc
gagttacttcgcgtctttgctgcgcccagccttcgtatacaaatattctccggtttgacg
actagaaacatcctcctcttccccccctccctctcgtctctctctctctcacagatctcg
ccgttttggttcgtccggtcgtttactcccgcatcagccatggcagcctcctcctcctct
ccagaagccgccccgacgggacccgcggatgccatcagcagggatcggatcctctccagc
aatctctacttcgacgttccgccctccaaggtgcctgtgatctactcgtcatcctacgac
atcgcgttttttggaatcgagaaactgcatccatttgattcatccaagtggggccgtatt
tgccaattcttaattaaggaaggtttcttagacaagaaacaaacggtagaaccactagaa
gcttcaaaagatgacttactggtggtgcattcagaatcatacttgagcagtctcaagagc
agcttaaatgttgccattattattgaggtccctcctgtttctttgcttcccaattgcctt
gtacagaataaagtgctttacccatttcgcaagcaggtgggaggttccatactggcagcc
aaacttgcaaaagaacgagggtgggccatcaatattggtggtggtttccatcattgttca
gcagaaaaaggaggtggattttgcgcgtatgctgacatttcactttgtattcagtttgct
tttgttcttttgaatatttcaagagtaatgataattgatcttgatgctcaccaagggaac
ggccatgaaatagacttctctaatgacagaagggtttatattctggacatgtacaatgct
ggaatatatccatttgactttgaggctaagagatacattgatcagaaagttgagttagca
agtgggaccaaaacaaaggaatatctggataagttggatgaagcgctcaaggttgcaaga
aataacttcaatcctgagttggtggtatataatgctggcactgatatcctagacggagat
cctttgggcagattgaagatcagtcctgatggagtgatgactagagatgagaaggttttc
agatttgctagagaaaaaaatataccacttctgatgcttacttcaggtggctatatgaag
tctagtgctcgagtaatagcagattcaattataaatctttccaagaaaaacttgatagca
ttggacagtcctctgggtagaaagtaa

DBGET integrated database retrieval system