KEGG   Musa acuminata (wild Malaysian banana): 103975744Help
Entry
103975744         CDS       T03447                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like isoform X1
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103975744
Enzymes [BR:mus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103975744
Chromosome [BR:mus03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103975744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 373 aa AA seqDB search
MKNKIFCGGGGGGSGGTVFQQLMQQLGDEEPVDFQLPDWSKKQKSAPYNFIRRNVYLTKR
IKRRAADDGIFCSCSPSPGNSVVCGRDCLCGMLLSCCSQSCKCGNLCVNKPFQYRPVKKM
KLIETEKCGSGVVTEEDIRQGDFVIEYVGEVIDDKTCEERLWKMKHCGETNFYLCEINRD
MVIDATYKGNKSRFINHSCQPNTEMQKWTIDGEIRIGIFATRDIKKGEELTYDYQFVQFG
ADQDCYCGSVGCRKKLGNKPSKLKFSSSDTALQLVLCEIAASSPNSKALLYGKANLESGR
LNMEGSPSFVARKRKSEFHNCIYEVVRIWSPQYKRYYGGVILEFDCYSRKHTIITEDERV
ENVDLSKEDWDFL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagatcttttgcggcggcggcggcggcggcagtggcggaacggtattccaa
cagctgatgcaacagctcggagacgaggagcccgtggatttccagctgccggactggtcg
aagaagcagaaatcagcgccctacaacttcataaggcgcaatgtttatctcactaaaagg
ataaaaaggcgtgcggcagatgatggcatcttctgctcctgcagcccatcaccgggaaat
tcggttgtttgcggcagagattgcctctgtgggatgcttttgtcttgttgttctcaaagt
tgcaagtgtggaaatctatgtgtgaacaaaccgttccagtatcggcctgtgaagaaaatg
aagttaattgagacagaaaaatgtggatctggggtagtaaccgaggaggatataagacaa
ggagactttgtgatagaatatgttggtgaagtaattgatgacaaaacttgtgaagaaagg
ctgtggaaaatgaagcattgtggtgagacgaatttttacctgtgtgagatcaacagggac
atggtcattgatgctacatacaagggaaacaagtctagatttataaatcatagctgccag
ccgaatactgagatgcagaaatggacaattgatggtgaaatacgcattggtatatttgca
actcgtgatataaagaagggagaggagttaacatatgattatcagtttgtacaatttgga
gcagatcaagattgctactgtggttctgtaggttgcaggaagaaattgggaaacaagcct
agcaagctgaaattttcttcttcagacactgctttgcaactagttctttgtgagattgca
gcttcctctcccaattcaaaagcacttctgtatggaaaagccaatctggaaagtgggaga
ttaaatatggaaggatcaccatcttttgttgctcgcaaaagaaagagtgagttccataat
tgcatctatgaagttgtacgaatctggtctcctcagtataaaaggtattatggaggagtt
atactggaatttgattgctattctagaaaacacactataatcacagaggatgagagggtt
gaaaacgttgatctttcaaaggaagattgggattttttatga

DBGET integrated database retrieval system