KEGG   Musa acuminata (wild Malaysian banana): 103976989Help
Entry
103976989         CDS       T03447                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03030  DNA replication
mus03410  Base excision repair
mus03420  Nucleotide excision repair
mus03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mus00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103976989
   03410 Base excision repair
    103976989
   03420 Nucleotide excision repair
    103976989
   03430 Mismatch repair
    103976989
Enzymes [BR:mus01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103976989
    6.5.1.6  DNA ligase (ATP or NAD+)
     103976989
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103976989
DNA replication proteins [BR:mus03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103976989
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103976989
DNA repair and recombination proteins [BR:mus03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103976989
   NER (nucleotide excision repair)
    Other NER factors
     103976989
   MMR (mismatch exicision repair)
    Other MMR factors
     103976989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase HTH_36 TrmB
Motif
Other DBs
NCBI-GeneID: 103976989
NCBI-ProteinID: XP_009390651
LinkDB All DBs
Position
1
AA seq 750 aa AA seqDB search
MLLLRAPFLLSLKFPPLRPCFPSLPFSNPWSRNLFLRCCSTGRAAMSGRRTVADVLMGNA
RAAAAAAAKSKKSAPSSAQPEQPSPSPSKKPKTLDGGGQNPKDPPEEKNPTLDLKKKCSD
FNPKKAASWKDGEPVPFLFLARALELISNESGRIAITEIICNVFRTVIATTPGDLLATVY
LSANRIAAPHEGIELGIGDASLVKALAEAYGRKEEQVKKQLKELGDLGLVAKASRSSQKV
MFKPQPLTIAKVFDTFRAIAKESGKDSQDKKRNHIKGLLVAATECEPQYLVRLLQSKMRI
GLAEKTVLVALGQAAIYSETNQNPRSQTQSDLEEAAKIIKQVYSVLPIYDKIVPELLHVG
VWKLPEACNFSLGVPVGPMLAKPTKAVSEILDKFQGMEFTCEYKYDGERAQIHYMEDGSV
EIYSRNAERNTGKYPDVVGSVSRFKKPAVKSFVLDCEIVAYDREKQRILPFQILSTRARK
GVILSDIKVAVCTFAFDILYVNGQPLLQEQLKVRREHLYGSFEEVPGVFQFATAITSDDL
EEIQKFLDTAVNTSCEGLIIKTLDKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIAA
FHGRGKRTGVYGSFLLACYDEHNEEYQSICNIGTGFSESQLEERSTSLRNKIIPKPKPYY
RFSDTMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLHVRDDKSP
EEATTSEQVAEMYRAQKINHTNNQDEDDDD
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgctgcgagcgccgtttctcctgtcgctcaaattccctccactgcgtccctgc
ttcccatctctccccttctcaaacccttggtcaagaaacctcttccttcgctgctgcagc
accggccgtgccgcaatgtcgggccgccgcaccgtcgccgacgttctcatgggcaacgcc
cgcgccgcggccgcggccgcagccaaatccaagaagtccgccccatcctccgcccagccc
gaacagccttccccttccccttccaagaaaccgaaaaccctagatggcggtggccaaaac
cctaaagatcctcccgaggagaagaaccccaccctcgacctgaagaagaagtgctccgac
ttcaaccccaagaaagccgcttcgtggaaggacggggaacccgttcccttcttgttcctc
gcgcgcgcccttgagctaatctcgaacgagtccggaaggatcgccatcacggagattatc
tgcaacgtgttcaggaccgtgatcgctaccacgcccggggatcttctcgccaccgtttac
ctttcggcgaataggattgcggcgccccatgaaggtattgagcttgggattggggacgcg
tcccttgtgaaggcgcttgccgaggcttatgggaggaaggaggagcaagtcaagaagcag
ctaaaggaactgggtgacttgggtcttgttgcaaaagcaagccgttcctctcagaaagtg
atgttcaagcctcaacccttgacgattgccaaggtttttgatacattccgtgcaattgca
aaggagtcgggaaaagatagtcaagacaagaaaagaaatcacataaaaggacttcttgtt
gcagcaactgaatgtgaacctcagtatttagttcgtcttcttcagtcgaagatgcgaatt
ggtttggcagagaaaactgtcctggtagctctcggacaagcagctatttattctgaaacg
aatcaaaatccacggtcacaaactcagtctgatcttgaagaggctgcgaaaattatcaaa
caagtttattcggtactcccaatctatgataaaattgttcctgaacttctccacgttgga
gtatggaaacttccagaggcatgcaatttctccctaggtgtgcctgtagggcctatgtta
gctaaaccaacaaaggcagtgtctgaaattcttgataagtttcagggaatggaattcact
tgcgaatacaaatatgatggtgaacgagcccagatacattatatggaggatggatcagtt
gagatatatagtcgtaatgctgaaaggaacactgggaagtacccagatgtggtcggttct
gtatcaagattcaaaaaacctgctgtaaaatcatttgtgcttgattgtgaaattgttgct
tatgaccgtgagaagcaaaggatcttgcctttccagatattgagcactcgtgctcggaag
ggagtgatcttaagtgacataaaagtagctgtttgcacctttgcctttgacattctgtat
gtaaatggccaacctctacttcaggagcaactgaaagttcgtcgagagcacctttatggt
tcctttgaagaagtacctggagtctttcagtttgcaactgcaataacatcagatgatctc
gaggaaatacagaaattccttgacactgctgtcaacaccagttgcgaaggattgattatc
aagacattggataaggatgctacatatgagccttcaaagcggtcaaacaattggttgaag
ttgaagaaagattatatggaaagcattggtgattcacttgatttggttcctattgctgca
ttccatggtcggggaaagcggacaggtgtttatggctcatttcttcttgcttgctacgat
gaacataatgaagaatatcaaagcatctgtaacataggtactggtttctctgaatcacag
cttgaagaacgatcaacaagtcttcgtaataaaataattccaaagcctaagccatattat
cggttttcagatacaatggatccagatgtatggtttgagccatcagaggtttgggaggtt
aaagcagcagatttgagcatcagtcctgttcaccgtgctgctaatggtatagtcgatcca
aacaagggaatttcacttcgatttcctcgcttactacatgtccgtgatgacaaaagccct
gaagaagctacaacatctgagcaggttgctgaaatgtatcgtgctcagaagatcaaccac
acaaacaatcaagatgaggatgatgacgattaa

DBGET integrated database retrieval system