KEGG   Musa acuminata (wild Malaysian banana): 103978458Help
Entry
103978458         CDS       T03447                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103978458
   00051 Fructose and mannose metabolism
    103978458
   00052 Galactose metabolism
    103978458
   00500 Starch and sucrose metabolism
    103978458
   00520 Amino sugar and nucleotide sugar metabolism
    103978458
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103978458
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103978458
Membrane trafficking [BR:mus04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103978458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 500 aa AA seqDB search
MGKAAVTTAVVCAAAACAVAALVVRYRMRSSGRWARVAALLKELEERCATPVGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISYVNNLPTGEETGLFYALDLGGTNFRVLRVQLGGKERH
VLKQEFEEVSIPPLLMVGGSDELFDFIASALAKFVASEGEDFHLPVGRQREIGFTFSFPV
RQTSIASGTLIKWTKGFNIDETVGEDVVAELTRAIERQGLDMRVSALINDTVGTLAGGRY
HDNDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTDYDQ
ALDNESLNPSEQIFEKLISGMYLGEILRRVLLRLAKEASLFGDSVPPKLEIPFMLRTPVM
SAMHHDTSPDLKVVGAKLKDLLGIPNTSLKARKVVVQICDIVARRGARLAAAGVAGILKK
VGRDTAVKGGESVPRTVVAMDGGLYEHYTIFRECLQATFEEMLGAEAAASVVIKLANDGS
GIGAALLAASHSQYRELEQS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggcggcggtgacgacggcggtggtgtgcgccgcggcggcatgcgcggtggcg
gcgctggtcgtgcggtaccggatgcggagctccggtaggtgggcgcgggtcgccgccctg
ctgaaggagcttgaggagcggtgcgccacgcccgttgggaagctgcgacaggtggcggac
gcgatggcggtggagatgcacgccgggctcgcctccgagggcgggagcaagctaaagatg
ctaatcagctacgtcaacaacctcccgaccggggaggagacagggttgttttatgcttta
gaccttggcggaaccaacttccgcgtcctacgtgtgcaactggggggtaaggagaggcat
gtactaaagcaagaatttgaggaggtctccattccaccgcttctaatggttggaggctca
gatgaactttttgatttcattgcttcagctttagcaaagtttgttgcttctgaaggtgaa
gattttcaccttcctgttggtaggcagagggaaattggatttaccttttcttttcctgtg
agacaaacctctatagcatcaggcaccttaattaaatggacgaaaggtttcaatattgat
gagacggttggggaagatgtggtggctgaattgactagggccatagaaagacaaggtctt
gatatgcgagtatcagctttgattaatgataccgttggaacattagctggggggagatat
catgataatgatgtagttgctgccgtgatattgggcaccggcacaaatgcagcctatgta
gagcgtgcccacgcaatacctaagtggcacggtctcttgccaaaatcaggagagatggtt
atcaacatggagtggggaaactttaggtcatcccatcttcctttaacagactatgatcaa
gcattagataatgagagtttgaaccctagtgaacagatttttgaaaagttgatctctgga
atgtacctgggagaaattttacgacgagtccttttgcggctggctaaggaagcttccctt
ttcggagacagtgttcctccaaaacttgaaattccgttcatgctacggactccagtcatg
tcagccatgcatcacgacacatcacctgatcttaaagttgttggtgccaaactgaaggac
ctcttggggatccccaacacctctctcaaagcaagaaaagtggtggtccagatctgcgac
atcgtcgccaggcgtggcgctcgcttggccgccgctggtgtagccggcatcctgaagaag
gtcgggcgagacacggcggtgaagggcggagagagcgtgccaaggacggtcgtcgccatg
gatggtggactctacgagcattacaccatattccgcgagtgcttgcaggccaccttcgag
gagatgctcggagccgaggccgcagcttctgtcgtcatcaagctagcaaatgacggatcg
ggcatcggcgccgccctcctcgcagcttctcactctcagtatcgagaactcgaacagtcc
tga

DBGET integrated database retrieval system