KEGG   Musa acuminata (wild Malaysian banana): 103988040Help
Entry
103988040         CDS       T03447                                 

Definition
(RefSeq) histone deacetylase 9 isoform X1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
Enzymes [BR:mus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103988040
Chromosome [BR:mus03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103988040
   HDAC complexes
    Sin3A-HDAC complex
     103988040
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103988040
  Chromatin remodeling factors
   NuRD complex
    103988040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 431 aa AA seqDB search
MPPKERIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLYKKMEIYRPHKAYPVEL
AQFHSADYVEFLHRISPNTQHLFADELARYNLGEDCPVFENLFEFCQMYAGGTIDAARRL
NHQLCDIAINWSGGLHHAKKSAASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKFGDMFFPGTGDVKDIGEREGKYYAINVPLKDGIDDASFTRLFKT
IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY
TKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENLNSKSYLSTIK
VQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGD
NDNDHNMEDGP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaagaacggatcgcgtacttctacgacggagatgttgggaatgtatatttt
ggaccaaatcatccaatgaaaccacatcgtttgtgtatgacacaccatcttgtgctttca
tatggtctttacaagaagatggagatatatcggccacacaaggcataccccgtggagctt
gcccaatttcattcggcagattacgtggaatttttgcaccggataagccctaatacacaa
catttgttcgctgatgagttagctagatataaccttggagaagactgccctgtctttgag
aatcttttcgagttctgccaaatgtatgctggtggcacaattgatgctgcacgaaggttg
aaccatcaactctgcgatatcgctataaattggtctggtggcttacatcatgcaaaaaag
tctgcggcatcgggcttctgctatatcaatgacttagtcttgggaattctggaacttctt
aagtatcatgcccgtgttctttatattgatatagatgttcatcatggtgatggcgttgaa
gaagccttttatttcacagacagggtaatgactgtgagtttccataaatttggtgatatg
ttcttcccaggaactggcgatgttaaggatataggtgaaagagaagggaaatattatgcc
attaatgtcccactcaaggatggaatagatgatgctagttttactcgactattcaaaacg
attattgccaaggttgttgaaacatatctaccaggtgtaattgttcttcaatgtggagct
gattcacttgcgggtgaccgcttaggctgtttcaatctctccattgaaggacattctgaa
tgtgtaaaatttgtgaagaaattcaatttgcctctgttggttactggtggtggaggatac
acaaaagaaaatgttgctcgctgctggactgttgaaactggtgttttgttagacgcagat
cttccaaatgaaattccagaaaacgagtatatcaagtattttgcaccagattatacttta
aaaattccgaatggcaatatggagaacttgaatagcaagtcatatcttagcacaatcaag
gtgcaagttctagaaagtttacggtgcatacaacatgctcctggggttcaaatgcaggag
gttccgccagatttttatatcccagaatttgacgaagatgaacaaaatcctgatgaacga
gttgatcagcataccaccgataagcaaattcagcgagacgacgagtatttcgaaggggac
aacgataatgatcacaacatggaggatggcccttga

DBGET integrated database retrieval system