KEGG   Musa acuminata (wild Malaysian banana): 103995944Help
Entry
103995944         CDS       T03447                                 

Definition
(RefSeq) DNA ligase 4 isoform X1
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mus00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    103995944
Enzymes [BR:mus01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103995944
DNA repair and recombination proteins [BR:mus03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     103995944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 1155 aa AA seqDB search
MTDTTVKFGLLVSMFQAMLRDRTAAKKRKRFRTFLDRVYTGREYFSAVRLILPGLDRERG
TYGLKESTLATCVVDALGLAKDSPDALRLVNWRKGGARSGANAGNFALIAAEVLQRRQGM
VSGGLTIRELNNLLDQLASTENRGEKAVILSSLIKKTNALEMKWILMIILKDLKLGISEK
SIFHEFHPDAEDLFNVTCDLKLVCEKLKDHTQRQKKQDIEVGKPVRPQLAMRVGDATTAW
KKLHGKHVVVECKFDGDRIQIHKNGEEIHFFSRNFLEHPEYAHGMSNVIVQNILVQRCIL
DGEMLVWDMATQHFAEFGSNQEIAKAAKEGLESNRQLCYIAFDILYVGDTSVIHQSLTER
HSLLQKVVKPVKGRLEILVPDGGINDHRPPGQPFWSTVAYNVEDVERFFKDTIENRDEGI
VLKDLGSKWEPGDRSGKWLKLKPDYIHAGSDLDVLIIGGYFGSGRRGGEVSQFLVGLAEL
SDHTSYPKRFISFCRVGSGLSNDELNALVAKLKPYFRKNEYPKRVPHFYEVTNNSKERPD
VWIESPDKSIVISITSDIRTVKSEVFAAPYGLRFPRITRVRYDKPWYECLDVQSFIELVQ
SSNGNTRRADDAGLQNENPKHTRNTRRGERKKVTVVPAHFIQTDTSDVREETFIFANMVF
YFVNIPPSYSVDYFHKVVVENGGTFSMNLNDSVTHCIAAEKKAGIKYQAAVHHGDVIHYS
WVLDCCKQKRLLHLQPKYFLFFAGPSRKKILEEFDAFSDHYYWDLDVTDIKQIFSNIVGL
ESSDRVEYYRKKYCPVESLCLFRGCCIYFFKALPIINTDCKEVSELALRRMRLEITMHAG
EVCDSLTRATHLLVYSTNESYNFDHLYKSFPLIHRHLLHSKKLHIVRYQWLEDSVKKAKK
LPEDPYNLNPDSLEDLEVDNSEHGLPASTSNMENQSVSTLLDKYETGKRARPIQRNTGKG
NPRSTRRMRARIGNRPAKIDREESVSSDSAVVTGREEALESRKYNNIMGEGESANDNTRI
EGESAKTCESLGGTLVWGQTGSEDMHPAELHKKKDSDVGSDSMHVIEDRLGEGEKLEQMV
DPLHAMLLDMVPSLSQRNVEGESCSLGGEKQQQQDINANPVKKVDGEKEKLNVDANPVKK
KVSYKDVAGQLLEDW
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atgacggatacgacggtgaagtttgggctactggtaagcatgttccaggcgatgctccgt
gaccggaccgccgccaagaagcggaagcggttccggacgttcttggaccgggtctacacc
ggccgcgagtacttcagcgccgtccgcctcatccttccgggcctcgaccgcgagcgcggc
acctacggcctcaaggagtccaccctcgccacttgcgtcgttgacgccctcggccttgcc
aaagactcccccgacgccctccgcctcgtcaattggcggaagggcggcgccagatccggt
gctaatgccggaaatttcgccctcattgccgccgaggtgttgcaacgtaggcaggggatg
gtttctggcggacttacaatcagggagcttaacaatttgcttgatcaattggcatcaaca
gaaaataggggggaaaaggctgtgattctgtcaagtctcatcaagaaaacaaatgcgttg
gagatgaagtggattttgatgatcatcttaaaagatttaaagctgggaattagtgaaaag
agcatatttcatgaatttcatcctgatgctgaagatttgttcaatgtcacctgtgacctt
aaattagtatgtgaaaagctgaaagatcacactcaacgacaaaagaaacaggatatagaa
gtcggaaaacctgttagaccacagttggctatgagagtcggtgatgcaacaactgcctgg
aagaagcttcatgggaagcatgttgttgttgagtgtaaatttgatggtgaccgcattcaa
atccacaaaaatggagaggaaatacactttttttcaaggaacttcctcgaacaccctgag
tatgcacatggcatgtcgaatgttattgtacagaacatactggttcagaggtgtatattg
gatggtgaaatgctggtttgggatatggctactcaacattttgcagaatttggttcaaat
caagagatagcaaaggcagcaaaggaaggattggagagcaatcgccagttgtgctatatt
gcttttgatattctctatgtcggagacactagtgtgattcatcaaagtctgacggagcga
cacagtctcctgcaaaaagttgtaaaacccgtgaagggacgcctagaaatattggttcct
gatggaggcattaacgatcatcgtccgccgggtcaacctttctggtctactgttgcttac
aatgtggaagatgtggagaggtttttcaaagacaccattgagaacagagatgagggaatt
gtgctgaaggaccttgggtccaaatgggaacctggtgatcggagtggaaaatggctgaag
ctgaaacctgattatatacatgccggttcagacctagatgttcttattattggtggttac
tttgggtctggacgtcgaggaggagaggtatctcagtttctagtaggtcttgcggagctt
tcagatcatactagctatccaaaacgatttatttcattttgtcgagttggtagtgggctc
tctaatgatgaattaaatgctctagttgccaagttgaaaccttatttcaggaaaaatgag
tacccaaagagagtaccacatttttatgaagttacaaataattcaaaggagaggccagat
gtctggattgagagccctgataaatcaattgttatctctataactagcgacatccgaaca
gttaaatcagaggtgtttgcagcaccatatggtctaagattccctcgaattactcgggtg
agatatgacaagccatggtatgagtgtcttgatgtgcaatcatttatagaactggttcaa
tcgagcaatggaaatacacggagggcagatgatgctggcttgcaaaatgaaaatccaaaa
cacacaagaaacacaaggagaggagagaggaagaaggtgactgtggtcccggctcatttt
atccaaactgacacctcagatgttagggaggagaccttcatatttgcaaacatggtgttt
tactttgtcaacattcctccttcctactctgtggactactttcacaaagtagtggttgaa
aatgggggaacattctccatgaatcttaatgactcagtaactcactgcattgcagctgaa
aagaaagcaggaattaaataccaggcagcagttcaccatggagatgtcattcactattct
tgggtcttggattgttgcaaacaaaagcggcttcttcatctgcaacctaagtacttcctg
ttttttgccggtccttcaaggaaaaagattctggaggaatttgatgcattctcagatcat
tattactgggatctcgacgtcacagacatcaaacagatattcagcaatattgttggatta
gaaagttccgacagggtagagtattacaggaagaagtactgtccagtggaaagtttgtgc
ttatttcgaggttgttgcatttacttctttaaagcactgcctatcataaataccgattgc
aaggaagtatcagagcttgcattgaggagaatgagacttgaaataacaatgcatgctggt
gaagtttgtgacagccttacgcgtgctactcatttgctagtctattcgacaaatgaaagc
tataactttgatcacttatataagagctttccacttatacatagacatcttctgcatagc
aagaagttacacatagtgagatatcaatggctggaagattctgtgaagaaggccaagaag
ctgcctgaggatccttataatttgaatcccgattccttggaagatctggaagttgataac
agtgagcatggccttcctgcttcaaccagtaacatggagaaccagagtgtctcaacattg
cttgataaatatgaaactggaaaaagagcgagacctatacaaagaaacacagggaaggga
aatccaagatcgactagacgtatgcgagcaagaattggaaatcgacctgcaaaaatagat
agagaggaatcagtgagcagcgattcggcagtagtaactggtcgagaagaagctctggag
tcgagaaaatacaataatataatgggtgagggtgagagtgccaatgataatacgaggatc
gagggtgagagtgccaaaacatgtgaatcacttggaggtacacttgtttggggtcagact
gggtctgaagatatgcatccagctgaactgcacaaaaagaaagacagtgatgtaggatca
gatagcatgcatgtgatagaagaccgcttaggggaaggcgaaaagttggagcagatggta
gatccattgcatgctatgttactagatatggtaccaagtctcagccagagaaatgtggaa
ggcgagagttgcagtcttggaggtgagaaacagcagcagcaagatatcaatgccaatcca
gtgaagaaggttgatggtgagaaggagaagctaaacgttgatgcaaatccagtaaagaag
aaggtgagttacaaggatgttgctggtcagctcctcgaagattggtga

DBGET integrated database retrieval system