KEGG   Musa acuminata (wild Malaysian banana): 103997442Help
Entry
103997442         CDS       T03447                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103997442
   00020 Citrate cycle (TCA cycle)
    103997442
   00620 Pyruvate metabolism
    103997442
Enzymes [BR:mus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103997442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 472 aa AA seqDB search
MAALLHLRLNSSLLPSSSSHPSLRRRPCRRPVAPSTRISAKIREIFMPALSSTMTEGKIV
SWVKSEGDRLAKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAPVGSAIALLAESE
DEIPLAKSQASSSSSAVAASPPPADAPASTTSVQTLAPSPPEPSPVAASSSTHPASDGGR
IVATPYAKKLAKDLKVDLAGVAGTGPMGRIVAKDVEAAAAAAVASVPSVPSKAVVGSVSA
KAPTPLAIELGTVVSFTTMQGAVSKNMVESLSVPTFRVGYTITTNALDDLYKKIKSKGVT
MTALLAKATAIALTKHPVVNSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLQDADKVDI
YSLSRKWKELVDKARAKQLQPHEYSTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQ
PTVVAAKDGRIGLKSQMQVNVTADHRVIYGADLAAFLQTLAKIIEEPSDLTL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctcctccatcttcgacttaactcctccctcctcccgtcttcctcctcccac
ccttccctccgccggcgaccctgccgccgccctgtcgctccctcgacgcggatctcggcc
aagatccgcgagatcttcatgcccgcgctgagctccaccatgacggagggaaagatcgtg
tcctgggtgaagtcggagggcgaccgcctcgccaagggcgagagtgtcgtcgtcgtcgag
tccgacaaggccgacatggacgtcgagacattctacgacggatacctcgccgccatcatg
gtcgaggagggcggcgtcgcccccgttggctctgccatcgccctcctcgccgagtccgag
gacgagatcccccttgctaaatcccaagcctcctcgtcctcctctgccgtcgccgcctct
cctcctcccgccgatgcgcccgcctccaccacttccgtgcaaaccttggccccttcgcct
ccagaaccctctccggtagccgcttcttcttcgacccacccggcgtccgacggtgggcga
atcgtcgccacaccctacgcgaagaagcttgccaaggatctgaaggtggacctggcgggt
gtggccggcacagggccaatggggcgaattgtagctaaggatgtggaagctgcggcagca
gctgctgttgcttctgtgccgagtgttccatcgaaagctgtggtgggatctgtgtcagcg
aaggctcctactcctctggctattgaactgggcactgtggtttcattcaccacaatgcag
ggtgccgttagtaagaacatggtggaaagcctctcggttccaacattccgagtaggttat
acgatcaccacgaatgcactcgatgatctctacaagaaaattaagtcaaaaggtgtcacc
atgactgccttgctagcaaaggcaactgctattgcgttgacaaagcacccagttgtaaat
tctagctgcagagatggcaagagttttacatacaacagcagcatcaatattgctgttgct
gtggccatagatggaggtttgatcacaccggtccttcaagatgccgataaggttgatatc
tactcattgtcaaggaaatggaaggagttggttgataaggcgagggccaagcagctgcaa
cctcatgaatacagcacaggtactttcactctttcaaaccttggaatgttcggtgttgac
cgctttgatgcaattctaccacccggaactggggcaatcatggctgttggtgcatctcaa
ccaactgttgttgccgccaaggatggcagaattggtctaaagagtcagatgcaggtcaat
gtaaccgcagatcacagagtcatttatggagctgaccttgctgccttcctgcaaacacta
gcaaaaatcattgaggagccatcagatctcaccctgtaa

DBGET integrated database retrieval system