KEGG   Musa acuminata (wild Malaysian banana): 103999064Help
Entry
103999064         CDS       T03447                                 

Definition
(RefSeq) probable glutathione S-transferase parA
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103999064
Enzymes [BR:mus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103999064
Transporters [BR:mus02000]
 Other Transporters
  Pores ion channels [TC:1]
   103999064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 223 aa AA seqDB search
MGEVDTKGVVLLDFWVSPFGQRCRIALAEKGVEYEFREENLGDKSPLLLKSNPVHKKIPV
LIHDGKPVCESLIIVQYIDEAWPDCAPLLPADPYARAQARFWADFIDKKIYECGTRLWKL
KGEGQAAAKEELIGILKLLEGELGDKKYFGGDAFGFVDIALVPFVSWFYTYETCAGFSIE
EAAPKLVAWGKRCMERESVAKTLSDPHKVYEFVGLLKKRFGVE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggtagacacgaagggggtggtgctgctggacttctgggtgagcccgttcggg
cagcggtgccggatcgcgctggcggagaagggagtggagtacgagttccgggaggagaac
ctgggggacaagagcccgctgctgctcaagtccaaccccgtgcataagaagatccctgtc
ctcatccacgacggcaagcccgtgtgcgagtccctcatcatcgtccaatacatcgacgag
gcgtggcccgactgcgcgccgctgctgcccgccgacccctacgcccgcgcccaggcccgc
ttctgggccgacttcatcgacaagaagatctatgaatgcgggacaaggctgtggaagctc
aagggcgaaggacaggcggcggccaaggaggagctcatcgggatcctgaagctgctggag
ggcgagctgggagacaagaagtacttcggcggcgacgcgttcggcttcgtcgacatcgcg
ctcgtcccgttcgtgtcctggttctacacctacgagacctgtgccggcttcagcatagag
gaggcagcgcccaagctggtggcgtggggcaagcggtgcatggagcgggagagcgtggcc
aagacactgtccgacccccacaaggtctacgagttcgtgggcctcctcaagaagagattc
ggagtcgagtag

DBGET integrated database retrieval system