KEGG   Mycobacterium vanbaalenii: Mvan_0735Help
Entry
Mvan_0735         CDS       T00449                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mva  Mycobacterium vanbaalenii
Brite
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mvan_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
775795..776502
Genome map
AA seq 235 aa AA seqDB search
MLRSVAAATLFAVPALALSACSPPGEVPSDSPGTTPPVWTGSPSPTAGPDEQGSGHGSGT
QAGGETLTADLKLADGTTVATADITFSDGYATVTVEASGAGELTPGFHGIHIHSVGKCEA
DSVAPTGGAPADFNSAGGHFQVSGHSGHPASGDLSSLQVREDGSAKLVTTTDAFTKEDLL
DGAGTALIIHEKADNFANIPPERYQQVNGAPPPDQTTLATGDAGARVACGVITGG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggtccgtcgctgccgccacattgttcgcagtgcccgcacttgccttgagtgcg
tgctctcctcccggagaagtgccctcggattcgcccggcaccacgcccccggtatggaca
ggttcgccctccccgacggcggggccggacgagcagggttccggacacgggagcggtacg
caggcaggtggcgagacgctgacggccgacctgaagctggccgacggcaccaccgtcgcc
accgccgacatcacgttctccgacggctacgccaccgtcacggtcgaggccagcggtgcg
ggcgagttgacgccggggttccacggcatccacatccattcggtgggcaagtgcgaggcc
gactccgtcgcaccgacgggcggcgcaccggccgacttcaattccgcaggcggtcacttc
caggtgtccgggcacagcgggcaccccgccagcggcgacctgtcgtcgttgcaggtgcgc
gaggacggttcggcgaagctggtgacgaccaccgacgccttcaccaaggaagacctgctc
gacggcgcgggtaccgcgctgatcatccacgagaaggccgacaacttcgccaacatcccg
ccggagcgctaccagcaggtcaacggtgcgccgccaccggatcagaccaccctggcgacc
ggcgacgccggagcgcgggtggcctgcggtgtcatcactggcggctga

DBGET integrated database retrieval system