KEGG   Mycobacterium vanbaalenii: Mvan_3127Help
Entry
Mvan_3127         CDS       T00449                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mva  Mycobacterium vanbaalenii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3317131..3318861)
Genome map
AA seq 576 aa AA seqDB search
MAPSEATIPAVLADRAQQQPDDIAYTFVDYEADPAGISESLTWSEVHERVQIVAEKLSKI
GSPGDRAVILAPQSLEYVIGFLGAIQAGFIAVPLSMPQTRHHDERVTGAMKDSTPVVVLT
TSAVVDEVRKYGQADPKARPPKFLEVDTLDFDSPPKPAPQVPLPKTAYLQYTSGSTRQPA
GVVVTHKNVIVNLEQLLTDYYEACPGGAPEDTTVVTWLPFYHDMGLIVGVFIPMMLGRPA
VQMSPVAFMQKPARWMQQLGSHPSAFTAAPNFAFELAVKRTTDEDLAGKDLSTVKVMING
AERVHGATVRRFNERFAAFGLADSAMRPSYGLAEATVYVVASAGGRPPTAVRFDYEKLAA
GHAERCDDDGGAELIGCGVPRSTTVRVVDPDSLVENPAGKIGEVWLHGDHVAAGYWHNPK
LSELFAAQLGEPSAGTPKGPWLRTGDLGVMFDDELYIIGRIKDLLIVDGRNHYPDDIEAT
VAEFTGGRVAAISVPDEASEKLIVIAELKKQADPALLESVKQQVTAAISQTHSVRLSDFV
LVAPGSLPLTTSGKVRRASCVELYRNDKFSRLDATT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctgaagccacgatccctgcggtcctcgccgaccgcgcgcagcagcagccc
gacgacatcgcgtacaccttcgtcgactacgaagccgacccggccggaatctcggagagc
ctgacctggtcggaggtgcacgagcgcgtccagatcgttgccgagaagctctcgaagatc
ggctcaccaggggaccgggccgtgatcctggccccgcagagcctggagtacgtcatcggt
ttcctgggcgcgatccaggcgggcttcatcgccgtgccgctctcgatgccgcagacacgt
caccacgacgagcgggtgaccggcgcgatgaaggattcgacccccgtcgtggtgctgacc
acctcggcggtcgtcgacgaggtccgcaagtacgggcaggccgaccccaaggcgcggccg
ccgaaattcctcgaggtcgacacgctcgatttcgactcgcctcccaagccggcgccgcag
gtgccgttgcccaagaccgcgtacctgcagtacacgtcgggttcgacccggcagccggca
ggcgtggtggtcacccacaagaacgtcatcgtgaacctcgagcagctgctcaccgactat
tacgaggcgtgccccggcggtgcgcccgaggacaccaccgtcgtgacgtggttgcccttc
taccacgacatgggcctgatcgtcggcgtcttcatcccgatgatgctgggccgccccgcg
gtgcagatgagcccggtcgcgttcatgcagaagccggcccgctggatgcagcagctggga
tcacacccgagtgcattcaccgcggcgccgaacttcgcgttcgagctcgccgtcaaacgc
accaccgacgaggatctcgccggtaaggacctcagcaccgtcaaggtgatgatcaacggc
gccgagcgggtgcacggcgccaccgtgcggcggttcaacgagcggttcgcggcgttcggc
ctggccgactcggcgatgcgcccgtcctacggtctggcggaggcgacggtctacgtggtg
gcgtcggcgggtgggcgtccgccgaccgcggtgcggttcgattacgagaagctggccgcg
ggccacgcggaacgctgtgacgatgacggcggcgccgagctgatcggctgcggtgtgccg
cggtcgacgacggtgcgcgtggtcgatcccgacagcctggtcgagaaccccgcaggcaag
atcggcgaggtgtggctgcacggcgaccacgtggccgccggctactggcacaacccgaag
ctgagcgagctgttcgccgcgcagttgggcgagccgagcgcgggcacccccaagggtccg
tggctgcgcaccggcgacctcggcgtgatgttcgacgacgagctctacatcatcgggcgc
atcaaggacctgctgatcgtcgacgggcgcaaccactatccggacgacatcgaggccacc
gtcgccgagttcaccggcggccgggtcgcggcgatctcggtgcccgacgaggccagcgag
aagctgatcgtgatcgccgagctgaagaagcaggccgatccagccctgctggagtccgtc
aagcaacaggtgaccgcggccatctcgcagacgcacagcgtgcgactctccgacttcgtg
ctggtcgcccccggctcgctgccgctgaccaccagcggcaaggtgcgccgcgcatcctgc
gtcgagctctaccgcaacgacaagttcagccgtctggacgccactacatga

DBGET integrated database retrieval system