KEGG   Methanosarcina vacuolata: MSVAZ_2921Help
Entry
MSVAZ_2921        CDS       T03815                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00500  Starch and sucrose metabolism
mvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSVAZ_2921
Enzymes [BR:mvc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSVAZ_2921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AKB45190
UniProt: A0A0E3Q8K0
LinkDB All DBs
Position
complement(3771440..3772576)
Genome map
AA seq 378 aa AA seqDB search
MKAVCICMGVHLPYSPKWYWPVEGFFGVPEMDRYFDRNSIFSKFLKTSRQFLRLNDLIME
SIERGGKYSFDLSGPFLGQCRWDPELLESFREFGENESVEFTGSCSYHSLSSLYPDLSWF
KEEVLIYREMIRELLDITPKTFVNTEILYTERVETILTDLGYNCLIAEGSRNLMNGYDPV
HVFENHLPTLLRHINLSEDLELRFSEKNWQGYPLIPEKFADWIASMEGDILTLYFNYTSL
CFHYRNKSMIDDFIRTFPEALKSRGIDMLTPSEAASRFEPLKLPTLGTEQTIRYGINNAL
GNHAQQLYLRELVRIEEELSGLKENKNYRELKHIFGYLQQSEIFFSMNSGNIREGYERAV
NYFSILSDFRRAVLEEGA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtatgcatctgtatgggagtgcatctgccttacagtcctaagtggtactgg
cctgtagagggattttttggggtgcctgaaatggaccggtattttgaccggaatagtatt
ttttcaaaatttttaaaaacaagccgacagtttttacgccttaatgatctgattatggag
tccatagaaagagggggaaaatattcctttgatctatccgggccattccttggacagtgt
cgatgggatcccgaacttctcgaatcattccgcgaatttggggaaaatgagagcgtggaa
ttcacagggagctgtagttatcactctctgagttcactatatcctgatctttcctggttt
aaggaagaagtgctcatttatagagaaatgatccgggaattactggatatcacccctaaa
accttcgtaaacacagagattctgtacaccgaaagagtagagacgattcttactgacctg
ggttataactgccttatcgccgaggggtccaggaatctcatgaatggatatgaccctgta
catgtatttgaaaaccatctcccgactttgttgaggcacataaacctgagcgaagacctt
gaactgcgcttttcggaaaaaaactggcaaggctatcctcttattccggaaaagtttgcg
gactggattgccagcatggaaggtgacatcctgactctttattttaattatacaagcctc
tgttttcactacagaaacaaaagcatgatagacgattttatcaggacgtttccagaggcc
ctaaagtccaggggaattgacatgctcacaccttctgaagctgccagtagatttgaaccc
ttaaagcttcctaccctgggaaccgaacagacaatccgttatgggataaataacgcatta
ggtaaccatgctcaacagctttacctgcgagaactggtaagaatcgaagaggaactctca
gggcttaaagaaaataagaactatcgagaacttaaacatatattcggttaccttcagcag
agtgaaatctttttttctatgaattctgggaatatcagggaaggatatgaaagggctgtc
aattacttttccatcctgtccgatttcaggagagctgtgctggaggagggagcatga

DBGET integrated database retrieval system