KEGG   Methanosarcina vacuolata: MSVAZ_3422Help
Entry
MSVAZ_3422        CDS       T03815                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00630  Glyoxylate and dicarboxylate metabolism
mvc01100  Metabolic pathways
mvc01120  Microbial metabolism in diverse environments
mvc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mvc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSVAZ_3422
Enzymes [BR:mvc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSVAZ_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB45691
UniProt: A0A0E3LIA7
LinkDB All DBs
Position
complement(4380434..4381720)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDMDYSPKDTDLVCEFHIEPSAGVNFEEAATHMAGESSIDSWTEIATLSPELAAR
LKPHVFYVDEDAQTVRVAYSEELFELGSVPQVLSAVAGNIFSMKIVDNLRLQDIAFPKSM
LSEFKGPGFGLPGIKELTGVQDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNRFEKRAELTLKLAEKAESETGERKMYLCNITAPTCKEMIRRMNILKDLGASY
AMIDIVPVGWTALQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLVGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDNVPADESQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYTIFGRDVIMQFGGGIHAHPMGTAAGATACRQALEAALEGVSLQEYAKNHRELEL
AIDKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagagattatatagacatggactatagcccgaaggatactgatctggtatgtgag
ttccatatcgaaccgtcagcaggagtgaattttgaggaagctgcaacccatatggcaggg
gaaagctctatagattcctggactgaaatcgccacactcagtcccgaacttgcagccagg
ctaaaaccccatgttttttacgtagatgaggatgcacagactgtaagggtagcttactcg
gaagaactctttgaacttggttctgtcccgcaggtactcagtgcggttgcaggaaatatc
tttagtatgaaaatcgttgacaatctcagactgcaggatatagctttcccgaagtcaatg
ctctccgaattcaaaggtcctggattcgggttgccaggaatcaaggaacttacaggtgtg
caggacaggcctctcataggaactattgtcaagccgaaagttggattaacctctgaaaaa
catgctgaggtcgcttacaattcatttgcaggaggctgcgaccttgttaaagatgacgag
aaccttacggatcagaaatttaacagatttgaaaaaagagctgaacttaccctgaagctt
gcagaaaaggcagaatctgagaccggagagcgtaaaatgtatctctgcaacattactgct
cctacctgtaaggaaatgatccgtcgcatgaacattcttaaagacctgggtgccagctat
gcgatgatcgacatcgtacctgtgggctggactgcacttcagaccctgagggaagaagca
gaagatgcaggacttgctctccatgcccaccgatgcatgcattcagcctataccaggaac
ccacgccatgggataagcatgcttgtcgttgccaagctctgcagattggtcgggcttgat
cagcttcacattggtactgtagtagggaaaatgcacggagaaaaacacgaggttctatct
ctccgtgatgagtgtgtgttagacaatgtgcctgcggatgaaagccagcacgtccttgcc
caggactggggagggttgaagcctatgttcccggttgcttccggagggcttgcccctact
atgattcctgacctgtacactatcttcggaagggatgttattatgcaattcggtggcgga
attcacgcccatccaatgggcacggcagccggagccactgcttgcaggcaggcactcgaa
gcagctcttgagggagttagcctgcaggaatatgcgaaaaaccacagagaacttgaactt
gccatcgataagtggctgaagaaataa

DBGET integrated database retrieval system