KEGG   Microterricola viridarii: AWU67_16710Help
Entry
AWU67_16710       CDS       T04252                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
mvd  Microterricola viridarii
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvd00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AWU67_16710
Enzymes [BR:mvd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AWU67_16710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3671828..3673102
Genome map
AA seq 424 aa AA seqDB search
MTANLTDSQTTRLACEDLDAADPLASFRGRFDLPPGVIYLDGNSLGALPKATAARIQHVV
IQEWGVGLIRSWNDAGWFDKPRALGERIAPLIGAGPGEVVIGDSTSVSLFQVAVAAARLR
PGRRVIVSERDNFPTDLYMLESVQELLGDASGALERRLIHDDGPSLDEVLDEDVAVVVLT
HVNYRTGRMYDMAEVTRKVHEAGALMVWDLCHSVGAVPVDLNGAGADFAIGCTYKYLNGG
PGSPSFIWVAERHQSSARPPLTGWHGHARPFEFGVEYAPAAGMTRFRIGTPQLLSLAGLE
ASLDLWDEVDLAQVRAKSLQLTDLFIALVDSRLAPWGVEIVTPREHAVRGSQVALRVADG
YPIMQALIERGVIGDFRGPDLIRFGFTPLYVSHADVWDAVEILEDILATESWRAERFSRR
GAVT
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacctgaccgacagccagacgacccgcctcgcctgtgaagacctcgacgcc
gccgacccgctcgcctcattccgcgggcgcttcgacctgccccctggcgtgatctacctc
gacggcaattccctgggcgcgctgccgaaagcgacagccgcacgcatccagcacgtcgtc
atccaggagtggggcgttgggctgatccgcagctggaacgacgccggttggttcgacaag
ccacgcgcgctcggcgagaggatcgcgcccctcatcggcgccggccccggcgaggtggtc
atcggggactcgacgtctgtgagcctgttccaggtcgccgtcgccgcggcccgtctgcgc
ccggggcgccgggtcatcgtctccgaacgcgacaactttccgaccgatctctacatgttg
gagagcgttcaggagctgctcggcgacgcgagcggtgcgctggagcgacggctgatccac
gacgacggcccgtccctcgacgaggtgctcgacgaggacgtcgcggtggtcgtgctgacg
cacgtcaactaccgcacgggccggatgtacgacatggccgaggtgacgcgcaaggtgcac
gaggccggtgcgctcatggtgtgggacctctgccacagtgtcggcgccgtgcccgtcgac
ctcaacggcgcaggcgccgatttcgccatcggctgcacctacaagtacctgaacggcggg
ccgggctcgccgtccttcatctgggtcgccgagcgccaccagagcagcgcccgcccgccg
ctcaccgggtggcacgggcacgcccgccccttcgagttcggcgtggagtacgcgccggct
gccggcatgacgaggttccggatcggcacgccacagctgctgtcgctggcggggctggag
gcaagcctggacctgtgggacgaggtcgacctggcacaggtgcgggccaagagcctgcag
ctcaccgacctgttcatcgcactcgtcgacagccgtctggcgccctggggcgtcgaaatc
gtgacgccgcgcgagcacgccgtgcgcggcagccaggttgccctgcgggtcgcggacggc
tacccgatcatgcaggcactcatcgagcggggcgtcatcggtgatttccgcgggccggat
ctcatccgtttcggcttcacacccctctacgtctcgcacgcagacgtgtgggacgccgtg
gagattctcgaggacatcctggccaccgagagctggcgcgccgagcgcttcagtcgtcgc
ggcgcggtcacctga

DBGET integrated database retrieval system