KEGG   Mycobacterium vaccae: MYVA_5421Help
Entry
MYVA_5421         CDS       T04356                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mvq  Mycobacterium vaccae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(5649224..5650267)
Genome map
AA seq 347 aa AA seqDB search
MPSPATEIDVDGVKVRLTNPDKPYFPKLGKDGTKGKLVEYYLAVADPMVMLLRDRPVHLQ
RFPDGIDGEEIYQKRVPQKHPDYLETCTVTFPSGRTADALKITHPSAIAWAAQMGTVTLH
PWQVRCPDTEHPDELRIDLDPQPGTGFKEARSVAVDVLKPLLDELGLVGYPKTSGGRGVH
VFLRIATDWDFTAVRRAGIALAREVERRAPDAVTTSWWKEERGERLFIDYNQNARDRTFA
SAYSARKTPIATVSTPLTWDELRGADPDDYTILTVPEFVAGRPDPWAGIDETAQSIDKLL
DMAKADEDRGLGDLPYPPNYPKMPGEPPRVQPSKKVAAHWDEEGNPK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccccgcaaccgaaatcgacgtcgacggcgtcaaggtccggctgaccaacccg
gacaagccgtacttcccgaagctcggcaaggacggcaccaagggcaagctggtcgagtac
tacctggccgtcgccgatccgatggtgatgctgctgcgcgaccgtccggtgcatctgcag
cggttccccgacggcatcgacggcgaggagatctaccagaagcgggtgccgcagaagcac
ccggactacctcgaaacctgcactgtcactttcccgtccggtcgcaccgcggacgcgctg
aagatcacccacccgtcggcgatcgcgtgggccgcgcagatgggaacggtgacgctgcac
ccgtggcaggtgcgctgcccggacaccgagcatcccgacgagctgcgcatcgacctcgat
ccccagccgggcaccggattcaaggaggcccgcagcgtggcggtggatgtgctgaagccg
ttgctggacgaactcggtctggtcggctatccgaagacctcgggcggccgtggcgttcat
gtgttcctgcgcatcgcgacagactgggatttcaccgcggtgcgacgcgccgggatcgcc
ctggcccgtgaggtggagcggcgcgccccggatgcggtgacgacgtcctggtggaaggag
gagcgtggcgagcgactgttcatcgactacaaccagaacgcccgcgaccgcaccttcgcg
tcggcgtactcggcgcgcaagaccccgatcgcgaccgtgtccacgccgttgacgtgggac
gagttgcgtggcgccgaccccgacgactacacgatcctgacggtgccggagttcgtcgcc
ggccgaccggatccgtgggccggcatcgacgagacggcacagtcgatcgacaagctgctg
gatatggcgaaggccgacgaggaccgcgggctcggggacctgccgtacccgccgaactac
ccgaagatgccgggcgaaccgccgcgggtgcagcccagcaagaaagtcgccgcgcactgg
gacgaagagggaaacccgaagtag

DBGET integrated database retrieval system