KEGG   Moritella viscosa: MVIS_3474Help
Entry
MVIS_3474         CDS       T03770                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mvs  Moritella viscosa
Brite
Enzymes [BR:mvs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MVIS_3474 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(3948324..3948836)
Genome map
AA seq 170 aa AA seqDB search
MKNYTLLTALTFLSTSVMAEIISVDIINLDSGKSTGIVTISESDYGTVFTPKLKDLPAGI
HGFHIHSNASCESSVKNGKTIQGGAAGGHYDPKETGKHGFPWTSDNHLGDLPALYVGIDG
VANQPVLAPRVKLSDVKGRALMVHLGGDNHSDHPKKLGGGGSRVLCGVIN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattacactttacttacagcactaacgttcctctcgacctctgtaatggctgaa
ataatatcggtagatattatcaaccttgactcagggaagtctacaggtatcgtaaccatt
tctgaaagtgattatggcactgttttcactccaaaattaaaagacttacctgctggaata
cacggctttcacatacattcaaatgcttcatgtgaaagcagtgttaaaaatgggaaaacc
atacagggaggggcggcaggtggtcactatgatccgaaagaaacaggtaaacacggcttt
ccttggaccagtgataaccacctaggtgacttaccagccttatacgttggaattgatgga
gtcgctaatcagcctgtattagcaccacgagtgaaactctctgacgtaaaaggcagagcg
ctaatggtgcacctcggtggtgataatcactctgaccaccctaaaaaattaggtggaggt
ggctctagggttttgtgtggcgtaataaattaa

DBGET integrated database retrieval system