KEGG   Myxococcus xanthus: MXAN_3537Help
Entry
MXAN_3537         CDS       T00366                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00020  Citrate cycle (TCA cycle)
mxa00480  Glutathione metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
mxa01210  2-Oxocarboxylic acid metabolism
mxa01230  Biosynthesis of amino acids
Module
mxa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mxa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MXAN_3537 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MXAN_3537 (icd)
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MXAN_3537 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABF88792
UniProt: Q1D6J3
LinkDB All DBs
Position
4121250..4122548
Genome map
AA seq 432 aa AA seqDB search
MAPPSSGEKISLQSGKLSVPDNPIIPFIEGDGTGRDIWRASQAVFDAAVEKAYKGKKKIA
WYEVLAGEKSFKAVNNWLPEETVEAFRTYLVGIKGPLTTPVGGGIRSLNVALRQMLDLYV
CLRPVRYFKGVPSPVKMPDKVDMTIFRENTEDIYAGIEFEAGTAAAEKFLGLLKQEFPKE
FGKIRFPSDVGLGIKPVSHEGSDRLIRAAIQYAVDHKRKSVTLVHKGNIMKFTEGAFRKW
GYELAAREFGDKVYTWDQWEATKAAKGEDAANAEQKAALAAGKILIKDSIADITLQQVLT
RPDEFDVIATLNLNGDYLSDALAAQVGGIGIAPGGNINYVTGHAVFEATHGTAPKYADQD
KVNPGSVILSGEMMFRHLGWYEAADLMIQGMDRAIASKTVTYDFARLMKQEGQSGVSEVK
CSEFGQAIIKNM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccccgtcatccggagaaaagatctccctgcagagcggcaagctgtccgtcccg
gacaacccgatcatccccttcatcgagggcgatggcaccggccgcgacatctggcgtgcg
tcccaggcggtgttcgacgccgcggtggagaaggcctacaagggcaagaagaagatcgcc
tggtacgaagtcctggccggcgagaagtccttcaaggcggtcaacaactggctgcccgag
gagacggtcgaggcgttccgcacctatctggtgggcatcaagggccccctgacgacgccg
gtgggcggcggcatccggtcgctgaacgtggccctgcggcagatgctggacctgtacgtc
tgcctgcgccccgtgcgctacttcaagggcgtgcccagcccggtgaagatgccggacaag
gtcgacatgaccatcttccgtgagaacacggaagacatctacgcgggcatcgagttcgag
gccggcacggccgccgcggagaagttcctgggcctgctgaagcaggagttcccgaaggag
ttcgggaagatccgcttcccgtccgacgtgggcctgggcatcaagccggtgtcccacgag
ggcagcgaccggctgatccgcgccgccatccagtacgccgtggaccacaagcgcaagagc
gtcacgctggtccacaagggcaacatcatgaagttcaccgagggcgccttccgcaagtgg
ggctacgagctggccgcccgggagttcggtgacaaggtctacacctgggaccagtgggag
gccaccaaggccgccaagggcgaggacgccgccaacgcggagcagaaggccgcgctggcc
gccgggaagatcctgatcaaggactccatcgcggacatcaccctgcagcaggtcctcacc
cgtccggatgagttcgacgtcatcgccacgctgaacctcaacggtgactacctgtcggac
gcgctggcggcgcaggtgggcggcatcggcatcgcgccgggcggcaacatcaactacgtc
acgggccacgcggtgttcgaggccacgcacggcacggcgcccaagtacgccgaccaggac
aaggtgaacccgggctcggtcatcctctccggtgagatgatgttccggcacctgggctgg
tacgaggcggccgacctgatgatccagggcatggaccgcgccatcgccagcaagacggtg
acctacgacttcgcccgcctgatgaagcaggaagggcagagcggcgtctccgaggtcaag
tgctccgagttcgggcaggccatcatcaagaacatgtag

DBGET integrated database retrieval system