KEGG   Myxococcus xanthus: MXAN_4414Help
Entry
MXAN_4414         CDS       T00366                                 

Definition
(GenBank) non-ribosomal peptide synthase
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABF92714
UniProt: Q1D438
LinkDB All DBs
Position
5449706..5461426
Genome map
AA seq 3906 aa AA seqDB search
MLLASAREEAPWSPTLLHCLRHRASTQPDAIAYTFVGDDASDETRISYRELDRRARAIAA
SLQRMDAAGERAILLYPPGLDYVAAFLGCLYANVIAVPAYPPDISRLNRSLPRLQAILTD
ARASIVLTTEMILSLVDSLEEQASQLRDRRWLATDLLEAGCEDGWREPEVTGQTLAFLQY
TSGSTGTPKGVMLTHGNLVHNSHLIGLGMELREGSVAVNWLPPYHDMGLIGGILQPLYNG
FHGVLLSPITFLQRPLSWLQAIERHRGTCAGGPNFAFDLCVRKTRPEEREQLDLRTWQVA
FCGAEPIRPETLARFARAFEPAGFRPEFFYPCYGLAEATLIAAGGVKAEPVRTGHFDARA
LQHGQGAPRDEGTGQDTVTLVSSGTQLPTQSLVVVDPQARTLQADGEVGEIWMSGPSVAQ
GYWGRPEETERVFQARLARGEGPFLRTGDLGFLRDGQLFVTGRAKDLIIIRGRNHYPQDL
EQTTEQSHPAIRPGCSAAFSVDVDGEEHLAVAFEVSARQEVSPDDVATSVQQAIAEHHQL
GVHAVLLLKAGALPKTSSGKIQRHACRAGFLDGTLELIGAWRNPAAQEAPSEQVAEAPHP
PGTPAWLRARVAALLRVSPASLDTQAPLTRYGLDSLQSLELHSELERELGIVLPLSALLQ
GESLDALARRLTEATPASEPNPGPAPLTGPLPLSYGQQALWFLHALAPTSAAYHVARAVR
VRSALDVAALRQALHALMERHPALRIRITSEAGQPRQEVMSPVEVPLRVEDASGHDEAWL
RERVTAEAERPFDLGQAPLFRVHLWTRLDANPILLLTLHHAVTDFWSLAVMAGELGALYA
AALRGRPAVLPPLPLTPMDHARWQREALAASSSAPGWAFWKQQLAGKLPVLELPTDATRP
PQQRFQGASRGLRLTPALTGRLRDLAREHETTLYTVLVAAFQALLHRYTGQDDLIIGSPA
SGRTRARLSGLVGYFTNPLPLRARFTPGLRFDTFLQQVRATVLGALEHQDIPFPALVEQL
QPKRDPARSPIFQAMLVLQKSHVGADLGLEALALDEAGVVVSLGELDLEAWPLNRGSAQF
DLSLALAETREGLCASMEYDTALFKAGTIDRMLGHLRVLLEAVTTAPTLPIDQVPLLTEE
ERAQLLDWNATAHVYEAPLTLHGLFEAQAARTPEAVALCFESETLTYGELDRRANQLAHH
LRGLGVGPEHRVGVCLERSLELVVSLLGVLKAGGAYVPLDPSYPQERLDFMLRDAAVRVL
LTQQRLAKVFTEAAVTRVFVDADERAPFQHAESPRRSASWSESLAYVIYTSGSTGRPKGA
MNTHAGVRNRLLWMQSEYGLSADDRVLQKTPLSFDVSVWEFFWPLMTGARLVLARPGGHQ
DPAYLKQLIQDEAITTAHFVPSMMQAFLAESAVEQCASLRRVFSSGEALSPELRDHFVAR
LPETRLYNLYGPTEAAVDVSAWDCHRSLPSRTVPIGQPVANTALYVLDTRLAPLPVGVPG
ELYIGGVQVGRGYLGRPDLTAERFVPDGFAREEGMRMYRTGDRARVLPDGSLEYLGRLDH
QVKVRGHRIELGEIEATLEQHPAVQQAVVLARTAVGDDVQLVAFISHRGHAPTPATLRDF
LAERLPGFMVPSHIGILAELPLGPSGKRDRLALASVQVEASDNGLEWMAPRTPTELTVAR
IWSDVLKRERIGANDDFFQLGGHSLLATRVVARLRAILGVEVPLHTFFAAPTVAALAERL
QSCRSGGPKPPPLHRRSEPGPAPLSFAQERLWLFAQMTGPTAIYNMPSAVRLKGTLDVPA
LERALGDVVRRHEALRTVPRVEAGAEPVQVVLPAEPLTMPRVDLRAMPEEQREPRAEALA
REEAALPFDLDQGPLLRARLLQLEDTHHILLLTLHHSASDGWSMGVFAREVSQLYGAFTR
GEPSGLPELPVQYSDYALWQRRWLESGELERQLRYWEQRLDALPRLQLRTDRPRPTVQRH
QGRSRRFLLPQPLVEQLEALGRAEGVTLFMVLLGVYNLVLHRYSGQDDIVVGTDVAHRNP
PEVEGLIGFFTNQLVLRADLSANPTVRELLARLRQVTLDAYEHQDVPFERLVRALKSERD
AGYAPLFQVKLVLQNAPPPLLTLQSLHTHVMDVEGGETARWDLLLDFSPGPEGLWARAEY
NTDLFDDATIVRLWEHFLLAARSVPSSLARPIATLPLLLPAEQELLARWNDTATGYPRDA
TIQALFEAHAAATPDAVALTCEHHQLTYGALNQRANQVAHHLRALGVSAGARVGLCLERS
LDMVVALLGILKAGGAYLPLDPTFPPERLGFLVQDARMAALVTRSGLADDLPVQWIPVVS
LDEDAAALAARPTANPTPVCNAEHEAYVLYTSGSTGKPKGVAVPQRAVVRLVRNTHYVHL
GPDETLLQFAPLAFDASTFEVWGALLNGARLAIHPPTTPSLEELGSFIARQGVTTVWLTA
GLFHQVVDHALESLASVRQLLAGGDVLSPAHVRRVVERYPGCRVINGYGPTENTTFTCCH
TVSPDEPLVNAVPIGRPISNTRIHVLNAALEPVPVGAPGELCAGGDGLALGYLNDPALTA
QRFIPDPFSPVPGARLYRTGDRCHVLPDGRVEFLGRVDEQVKLRGFRIEPGEIEAALALH
PTVHEARVMAREDGPGEKQLVAYLVARPSRELPPAEDLRRYLQARLPVFMVPSAFVTLAA
FPLTANGKVDRRALPAPTGPERAASERYVAPRTADEEVLAGVWSEVLGVDTPSLHDSFFD
AGGDSIRAIQFVARAAERGLKLSVAMLLENQTLQAVAEALRAGNTTEGPTAPTAPFDLVR
LVDRERLPAHIEDAYPLAALQGGMLFQSQLDTAAALYHDAFSFHLELDLDVPVFQAALQQ
VFARHTALRTSFELTRYSEPLQFVHRQVEPVLAVHDLRHLSTEEQDAHLEAWLEEDRARP
FDWSCAPLMRVTLHLRTSTTVQLSATFHHAILDGWSVATFFTELLADFVTLRGDRCPERT
APALPFREFIAMERETLQSPAVQQFWAQQLDGMEVTSVTRTLPPPPDAPARGLSQHPVPL
AASTHAGLQRLARLAAVPLKSVLLAAHLRVLGAVCGTTDVVTGLVSNGRPEVRDGERTLG
LFLNSVAFRQRLGGGTWVDLVRETFATERRLLPHRRYPLSRLQHPRSGQPPFEVLFNFVH
FHVYQGLLGIEGVRLVSPVRSIERLDLPLAAMFGVDPVTSELQLSLHHDPRRLDAGRVPW
LAECYARVLDAMAAQPQERHERVCLLSPAERERVLVDWNATRDPLPEDTCVHHLVETQAS
HTPDAPAVTFEERSFTYRQLDEQATLLARRLQSVGVGPDARVAIVLDRSLEMVVAMLGVL
KAGGAYVPLDPAHPKARLEAVLQEAHPAAVVTRRELAPNLPVREVPTLLVEDAPEHPLPP
LTRGVAPRNLAYVLYTSGSTGRPKGVMVDHGNLVNHFVTLDERIEARPAGTWLAVTPYTF
DISGVELVWTLTRGFHLVIHPEERHARRSVAEQIEHHAITHLQCTPSRASLLLQSPGMAR
ALARLRVLVLGGEALTPALAAELRTRLTGRLLNIYGPTETTIWSTTHAVEASGPTVPIGR
PVSNTEVYIVDAHGTPVPMGAAGELLIGGEGVSRGYLHRPELTAERFIPNPFSSRPGARL
YRTGDACRYQPGGVLEFLGRIDQQVKIRGYRIELGEVEAVLREHPALREAAVVARTQDDD
AARLVAYLVPSQRDTPLENLQALVAHVRAFLRERLPEYMVPSAFVPLEALPLNASGKVDR
QALPQPSSSLAEQRPAYIAPAGQLELDIAEVWRQDLRLDVVGRDENFFDLGGNSLLAARI
QARLTEKLQRTVTLLDIFTHPTVGALARHLSAMPEAPAMALEAQTQRQKEGLGRLKRLAK
RVKGDE
NT seq 11721 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgcgagcgcgagggaagaagccccctggagtcccaccctcttgcattgcctg
cgtcaccgcgcgagcactcagcccgacgccatcgcctatacgttcgtgggcgacgacgca
tcggacgagacgcgcatctcgtaccgggagttggaccgtcgcgcgcgcgccatcgcggcc
tcccttcagcggatggatgcggcgggcgagcgggccatcctcctctaccctccggggctg
gactacgtggccgccttcctgggctgcctctacgccaacgtcatcgccgttccggcctac
ccgcccgacatcagccgcctcaaccgctcactgccgcggctccaggcgatcctcaccgat
gcccgggcatccatcgtgctcaccaccgagatgattctctcgctggtcgactcgctggaa
gagcaggcgtcgcagctgagggaccgccgctggctggccaccgacctcctggaggcgggc
tgcgaggacggctggcgagaacccgaagtcacggggcagacgctggccttcctccagtac
acctccgggtccaccggcacgcccaagggggtcatgctcacgcacggcaacctggtgcac
aactcgcacctgattggcctgggcatggagctccgcgaggggtccgtagcggtgaactgg
ctgccgccctatcacgacatggggctcatcggcggcatcctccagccgctctacaacggc
tttcacggcgtgctgctgtcccccatcaccttcctgcaacgaccgctgagttggctccaa
gccatcgagcggcaccgcggcacctgcgcgggcggtcccaacttcgccttcgacctctgc
gtgcggaagacccgcccggaggagcgcgagcagttggacctgcgcacgtggcaggtggcg
ttctgtggcgccgaacccatccggcccgagacgctggcccgcttcgcccgcgccttcgaa
cccgcgggcttccggcccgagttcttctatccgtgttacgggctggccgaggccacgttg
atcgccgcgggcggcgtcaaggcggaaccggtgcggacgggccacttcgacgcgcgggcg
ctccagcacggccagggcgccccccgggacgagggcaccgggcaggacacggtgacgctc
gtcagcagcggcacccagcttcccacccagtcgctcgtggtggtggatccccaggcgcgc
acgctccaggccgacggagaggtgggggagatttggatgtccgggcccagcgtggcccag
ggctattggggacgccccgaggagacggagcgggtgttccaggcccgcctggcgcgaggc
gaagggcccttcctgcgcaccggggacctgggcttcctccgtgacggccagctcttcgtc
acgggccgggccaaggacctcatcatcatccgtggccggaaccactatccccaggacctc
gaacagaccaccgagcagagccaccccgcgatccgccccggatgcagtgccgcgttctcc
gtggatgtggacggagaagagcacctggccgtggcgttcgaggtctccgcccgccaggag
gtttcgcccgacgacgtggccacgagcgtccagcaggccatcgccgaacaccaccagctc
ggtgtccacgcggtgctcctgctcaaggcgggggcgcttcccaagacgtccagcggcaag
attcagcgccacgcctgccgcgcgggcttcctggacggaacgctcgagctgatcggtgcg
tggcgcaacccagccgcgcaggaggcgccgtccgaacaggtcgccgaggccccccacccg
cccggcacgcccgcgtggctccgggcccgggtcgcggccctgctccgcgtgagcccggcg
tcgctggacacccaagcgccactcacccgctacggtctggattcactgcagagtttggag
ctgcactcggagctcgagcgtgagctgggcatcgtcctccccctctcagccctgctccag
ggtgagagcctcgatgcgctcgcccgcagactcacggaggccacgcccgcgtccgagccc
aaccccggacccgcgccgctcacgggccccctgccgctctcatacggtcagcaggcgctg
tggttcctgcatgcgctggcgcccaccagcgccgcataccatgtggcgcgcgcggttcgc
gtccgctccgcgttggatgtcgccgccctgcgacaggcgctgcacgcattgatggagcgg
caccccgcactgcgcattcgcatcacctccgaagcgggacaaccgcggcaggaagtgatg
tctcccgtggaagtgccgctgcgggtcgaggacgcgtccggacacgatgaggcgtggctt
cgggaacgcgtcaccgccgaagcggagcgccccttcgatctgggccaagcccctctgttc
cgggtccacctgtggacccgcttggatgcgaatcccatcctgttgctgaccctgcaccat
gcggtgaccgacttctggtccctggcggtcatggccggcgagctgggcgcgctgtacgcg
gcggcgctgcgcggccgccccgccgtgttgccaccgctcccactcacgcccatggaccac
gcacgctggcaacgcgaggcgctggcggcgagttccagcgcgccgggctgggctttctgg
aagcagcagctcgcggggaagctgcccgtgctggagctgcccacggacgcgacacggccg
ccccagcagcgcttccagggagcctcacgcgggctgcggctcacgccggcgctcaccggg
cggctgcgcgacctggcgcgcgaacacgagaccacgctctacacggtgctggtcgccgcg
ttccaggcgctgctgcaccgctacaccggccaggacgacctcatcatcggttcgcccgcc
tcgggacgcacccgcgcccggctttcgggcctggtcgggtatttcaccaaccccctgccc
ctccgagcccgattcaccccgggcctgcgcttcgacaccttcctccagcaggtgcgcgcc
acggtgctcggtgcgctcgaacatcaggacatccctttccccgccctggtggagcaactc
cagcccaaacgcgatccagcccgctcccccatcttccaggcgatgctggtgcttcagaaa
tcccacgtgggcgcggacctcgggctggaagcgctcgcgctggatgaagccggagtcgtg
gtctcgctgggcgagcttgacctggaggcctggcccctgaaccggggcagcgctcagttc
gacctcagcctcgcgcttgcggagacgcgcgaggggctctgcgcgtccatggagtacgac
accgccctcttcaaggccggcaccatcgacagaatgctcgggcatctgcgcgtcttgctg
gaagccgtcaccaccgcgcccaccctgcccatcgaccaggtgccgctgctcacggaggag
gaacgcgcccagctcctggactggaacgcgacggcgcacgtctacgaggcgccactcacg
ctgcacggcctcttcgaagcccaggcggcccgaacacccgaggcggtcgcgctgtgcttc
gagtcggagacgctcacctacggcgagctggaccgccgcgccaaccagctcgcgcaccac
ctgcgcgggctcggcgtcggccccgaacaccgcgtgggcgtgtgcctggagcgctcactc
gaactcgtggtgtccttgctgggcgtgctcaaggcgggcggagcctacgtccccttggac
cccagctatccccaggagcgtctggacttcatgctgcgtgacgcggcggtccgggtgctc
ctcacgcagcagcggctggcgaaggtgttcacggaggccgctgtcacgcgcgtgttcgtg
gacgcggacgagcgcgcgcccttccagcacgcggaatccccgcgccgctccgcatcctgg
agcgagtcactcgcctacgtcatctacacctcggggtccacggggcggcccaagggggcc
atgaacacccatgcgggcgtccgcaatcgcctgctctggatgcagtcggagtacggcttg
agcgcggacgaccgcgtcctgcagaagacgccgctcagcttcgatgtttccgtctgggag
ttcttctggccgctgatgaccggagcgcggctggtgctggcgcggcctggaggacaccag
gaccccgcctatttgaagcagctcatccaggacgaggccatcaccacggcgcacttcgtt
ccctccatgatgcaggccttcctcgcggagtccgcggtggagcagtgcgcgagcctgcgc
cgcgtgttcagcagcggtgaggcgctctcgccggagctgcgcgaccacttcgtggcgcgg
ctgccggagacacggctctacaacctgtacggccccaccgaggccgcggtggacgtgtcc
gcatgggactgccaccgctcgcttccctcccgcaccgtgcccattggccagcccgtggcc
aataccgcgttgtacgtcctcgacacgcggctcgcgcccctgcccgtgggcgttccagga
gagctctacatcggcggcgtgcaggtgggccgtgggtacctgggccgcccggatttgacc
gcggagcgcttcgtgccggatggcttcgcgcgcgaggaaggcatgcgcatgtaccggacg
ggtgaccgcgctcgcgtgctcccggacggcagcctcgagtacctgggccggctggaccac
caggtgaaggtgcgtggccatcgaatcgagctgggcgaaatcgaagccacgctggagcag
cacccggcggtccagcaggcggtggtgctggcgcgcacggcagtgggggacgacgtccaa
ttggtggcgttcatctcgcaccggggccacgcccccacgccagcaacgctccgggacttc
ctggccgaaaggctccctgggttcatggtgccgtcccacatcggcatcctcgctgaactg
ccgctcggccccagtggcaagcgggatcgcctcgcgctcgcgtccgtccaggtggaggcc
tcggacaacgggctggaatggatggccccccgcacgcccaccgagctgacggtggcccgc
atctggagtgacgtcctcaagcgcgagcgcattggcgcgaacgatgacttcttccaactg
ggaggccactcactgctggccacccgggtcgtcgcccggcttcgcgccatcctgggcgtg
gaagtgccgcttcacaccttcttcgcggcccccaccgtggccgctttggcggagcggctc
cagtcctgccggagtggaggccccaagccgccccccctgcaccgtcgctccgagccgggc
cccgcgcccctgtccttcgcccaggagcggctatggctgttcgcccagatgacgggcccc
accgccatctacaacatgcccagcgcggtgcggctgaagggcacgctcgatgtgccggcg
ctggagcgcgccctgggcgacgtcgtgcggcggcacgaagccctgcgcaccgtgccacgt
gtcgaagccggcgccgagcccgtgcaggtggtgctgccggcggagcccctgacgatgccc
cgcgtggacctgcgggccatgccagaagaacagcgggaacccagggccgaagcactggcc
cgtgaagaggccgcgcttcccttcgacctcgaccagggcccgctcctccgcgcgcggctg
ctccagttggaggacacgcaccacatcctcctgctgaccctgcaccacagcgcctcggac
ggctggtccatgggcgtgttcgcgcgcgaggtaagccagctctacggcgcctttacccgt
ggcgagccatccggcctgccggagctcccggtgcagtacagcgactacgcgctctggcaa
cgccgctggctggagagcggcgagctcgagcgccagctgcgatactgggagcagcggttg
gatgcgctcccccgactccagctccgcacggaccggccccggcctacggtacagcgtcac
caggggcgcagccgccgcttcctgcttccccaaccgctggtggagcagctcgaggcgctc
ggccgagcggagggcgtcaccctcttcatggtcctgctcggcgtctacaacctcgtcctc
catcgctattcgggacaggacgacatcgtggtgggaacggacgtggcccaccgcaacccg
ccggaggtcgaagggctgattggcttcttcaccaaccagttggtcttgcgcgcggacctg
tccgcgaaccccaccgtccgtgagctgctcgcgcgcctgcgccaggtgacgctcgatgcg
tacgagcatcaggacgtgcccttcgaacggctggtccgtgccctcaagtccgaacgggac
gcggggtacgcgcccctgttccaggtgaagctggtcctccagaacgcgccgccgccgctg
ctcacgctgcagagcctccacacccacgtgatggacgtggagggtggcgagacggcccgc
tgggacctgctgctcgacttcagcccgggccccgaaggcctgtgggcccgggccgagtac
aacaccgacctcttcgacgacgcgaccatcgttcggctgtgggagcatttcctgctcgcc
gcgcggagcgtgccgtcctcattggcccgccccatcgccacgctcccgctcctgctgccg
gcggagcaggaactcctcgcccgctggaacgacacggccaccggatacccccgcgacgcc
acgattcaggcgttgttcgaagcccacgccgcggcgactccggacgcggtggcgttgacg
tgcgagcaccaccagctcacctatggcgcgctgaaccagcgggccaaccaggtcgcgcac
cacctgcgggcgctcggcgtgagcgcaggagcccgggtagggctgtgcctcgaacgctcg
ttggacatggtggtggccctgctcggcatcctcaaggccggcggcgcctacctgccgctg
gacccgacgttcccccccgagcgactgggtttcctcgtccaggatgcgcgcatggcggcg
ctcgtcacccgttcgggtctggcggacgatctgcccgtccagtggattcccgtggtgagc
ctggacgaggacgcagcggcgctggcggcccgccccacggcgaatcccacccccgtctgc
aacgcggagcacgaggcctatgtgctctacacgtccggctccaccggcaagcccaagggc
gtggccgtcccacagcgagccgtcgtccgcctggtccggaacacccactacgtccacctg
gggccggacgagacgctgctccagttcgcgccgctcgccttcgatgcgtccaccttcgag
gtctggggggccctgctcaacggcgcccgcctcgccatccatccccccaccacgccgtcg
ctcgaagagctgggaagcttcatcgcccgccaaggagtgaccaccgtgtggctcaccgcg
ggcctgttccatcaggtggtggaccacgcgctcgagtccctggcgtccgtgcgacagctc
ctcgcgggaggcgacgtgctctcccccgcgcacgtgcgacgcgtggtggagcggtacccg
ggctgccgggtcatcaacggctacggccccactgaaaacaccaccttcacctgctgccac
accgtgtcgccggacgagccgctcgtgaacgccgtgcccattggccgccccatctccaac
acgcgcattcatgtgctcaacgcggcactggagccggttcccgtgggcgcgcctggcgag
ctgtgcgcgggcggtgacggtctcgcgctcggctacctcaacgaccccgcgctgacggcg
cagcgtttcatcccagacccgttcagccccgtgccgggcgcacgcctgtaccgcacgggg
gaccggtgccacgtcctgccggatgggcgggtcgaattcctcgggcgcgtggatgaacag
gtcaagctccgcggcttccggattgagccaggggaaatcgaggcggccctcgcgctccat
cccaccgtgcacgaagcgcgggtcatggcccgggaggacggccccggagagaagcaactc
gtcgcctacctcgtcgccaggccgtcccgggaactcccgccagcggaggacctgcggcgc
tacctccaggcgcggctgcccgtcttcatggtgccctccgccttcgtgacgctcgcggcc
tttcccctgacggcgaacggcaaggtggaccgacgcgcgctccccgcgcccacgggcccg
gagcgtgcggcctccgagcgctacgtcgccccccgcaccgccgacgaggaggtgctggcg
ggcgtgtggtccgaggtcctgggcgtcgacacgccaagcctccacgacagcttcttcgac
gcgggcggggattccatccgcgccatccagttcgtggcccgggccgcggagcgcggcctg
aagctgtccgtggcgatgctcctggagaaccagacgctccaggccgtggcggaggccctg
cgcgcggggaacaccaccgaggggcccaccgcgcccaccgcgccattcgacctcgtccgc
ctcgtggaccgcgaacggctccccgcgcacatcgaagacgcgtatcccctggccgcgctc
cagggcggaatgctcttccagagccagctcgacacggccgcggcgctctaccacgacgcc
ttcagcttccacctggagctggacctggacgtgcccgtcttccaggcggccctccagcaa
gtgttcgcgcggcacaccgcgctcaggacctcgttcgagctgacgcgctactcggagcca
ctccagttcgtccaccgccaggtggagcccgtgctggcggttcacgacctgcggcacctc
tccaccgaggagcaggatgcgcacctcgaagcgtggctcgaggaagaccgcgcgcggccc
ttcgactggagctgcgcgccgttgatgcgagtcacactccacctgcgcacgtccaccacc
gtgcagctcagcgccaccttccaccacgccatcctggacggctggagcgtggccaccttc
ttcaccgagctgctcgcggacttcgtcaccctgcgcggtgacaggtgtccggagcggaca
gcaccggcgctccccttccgcgagttcatcgcgatggagcgagagacactccagtcccca
gcggtccaacagttctgggcgcagcagttggacggaatggaggtgacgtccgtcacccga
accttgccgcccccgcccgatgcgccagcacgggggctctcccaacatcccgtgcccctg
gccgcgtcgacgcacgccgggctccagcggctcgcgcgtctggccgccgtccccctcaag
agcgtgctgctggcggcccacctccgcgtcctcggcgccgtctgtggcaccaccgacgtg
gtgacgggcctggtcagcaacgggcgccccgaggtgcgcgacggcgagcgaaccctgggc
ctcttcctcaacagcgtcgccttccggcagcgcctgggcggcggcacctgggtcgacctg
gtccgcgagacgttcgccaccgagcggcgcctgctgccccaccggcgctaccccctgagc
cggctgcaacacccgcgcagcggacaaccgccgttcgaggtcctcttcaacttcgtgcac
ttccatgtgtaccagggcctgctgggcatcgagggcgtgcggctcgtcagcccggtccgc
tccattgaacgcctggacctgccgctggccgccatgttcggcgtcgatccggtgacttcc
gagctccagctctcattgcaccatgacccacggaggctggacgctggccgcgtaccctgg
ctggcggagtgctacgcgcgcgtactggacgccatggcggcccagccccaggagcgccac
gagcgcgtctgcctgctctcccccgccgagcgcgagcgcgtgctggtggattggaacgcc
acccgggatcccctgcccgaagacacctgcgtccaccacctcgtggagacccaggcctcg
cacacgcccgacgcaccggccgtcaccttcgaggagcgctccttcacctaccgccagttg
gacgaacaggccaccctgctggcccggcgtctccagtccgtgggcgtggggcccgacgcg
cgtgtcgccatcgtgttggaccgctcgctggagatggtggtggcgatgctgggcgtcctg
aaggcgggcggcgcctacgtgccgctcgatcccgcccaccccaaggcgcggttggaagcc
gtgttgcaggaagcccacccggcggccgtggtgacccggcgtgagctggcgccgaacctg
ccggttcgagaggtcccaacgctcctcgtcgaggacgcccccgagcacccgctccctccg
ctgacgcgaggcgtggcgccgcgaaacctcgcctacgtcctctacacctctggctccacg
ggccggcccaagggcgtcatggtggaccacggcaacctggtgaatcacttcgtcacgctc
gacgaacggattgaggcgcggcccgcgggcacctggcttgccgtcacgccctacaccttc
gacatttccggagtcgagctggtgtggaccctgacgcgcggcttccatctggtgattcac
cccgaggaacgtcacgcccgccgttcggtggccgagcagatcgagcaccacgccatcacc
cacctccagtgcacaccgtcgcgcgcctcgctcctgctccaatcccccgggatggcccgc
gcgttggcacggctccgggtgctggtgctcggcggcgaggccctgacgcccgcgctggcg
gcggaactgcgcacccggctcaccgggcggctgttgaacatctatggccccaccgagacg
accatctggtccaccacccacgcggtggaggcgagcggccccaccgtccccatcggccgg
cccgtgagcaacaccgaggtgtacatcgtggacgcgcacggcacgcccgtgcccatgggc
gccgcgggcgagctgctcattggcggagagggcgtctcgcgcggctacctccaccggccg
gagctcacggcggaacgcttcattccgaatccgttctcgtcccgcccgggcgccaggctc
taccggacgggcgacgcatgccggtaccagccgggcggcgtcctcgagttcctcggccgc
atcgatcagcaggtgaagatccgaggctaccgcatcgagctgggcgaggtcgaagccgtg
ctccgggagcaccccgccctccgtgaggccgctgtcgtggcgagaacccaggatgacgac
gccgcgagactggttgcgtacctcgttccgtcccagcgggacactccgctcgagaacctc
caggcgctggtggcgcacgtccgcgcgtttctccgggaacggctgccggagtacatggtg
ccctctgccttcgtgcccctggaggccctccccctcaacgccagcggcaaggtggaccgg
caggcgcttccgcagccctcgtcatccctggccgagcagcgccccgcgtacatcgcgccc
gcggggcagctcgaactcgacatcgccgaagtctggcgccaggacctgcgcctcgacgtg
gtgggccgcgacgagaatttcttcgacctggggggcaactccctgctcgccgcgcgcatc
caggcgcgactgacggagaagctccagcgcacggtgacgctgctcgacatcttcacccac
ccgaccgtgggcgccctggcgcggcacctgtcggcgatgcccgaggccccggccatggcc
ctggaggcgcaaacccagcggcagaaggagggcctgggccggctcaagcgcctggcgaag
agggtcaaaggcgatgagtga

DBGET integrated database retrieval system