KEGG   Myxococcus xanthus: MXAN_5862Help
Entry
MXAN_5862         CDS       T00366                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mxa  Myxococcus xanthus
Brite
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MXAN_5862 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7273263..7273841
Genome map
AA seq 192 aa AA seqDB search
MPQEEDTLMKIRALLTAAALTAALPALAQEGAGTPPPADKKTQPKGQTAKAQVKDSEGKD
VGEITLEQTKQGVLIKGKLSNLPPGQHAFHIHEVGKCEGPAFTTAGGHFNPTKKAHGLLA
PKGKHQGDLPNLYVAQDGTVQFDIFSQNGLTLKSLFDKDGSAVVVHAKEDDYHTDPAGDA
GGRIACGVVEKT
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaggaggaagacacactcatgaagattcgagccctgctcaccgccgccgcactg
accgccgccctccccgcactggctcaggagggcgcgggcacgccgccgccagcggacaag
aagacgcagcccaagggccagacggccaaggcccaggtgaaggactccgagggcaaggac
gtgggcgaaatcaccctcgagcagaccaagcaaggcgtcctcatcaagggcaagctgagc
aacctgccgccgggccagcacgccttccacatccacgaggtgggcaagtgcgaggggccc
gccttcaccacggcgggcggccacttcaaccccaccaagaaggcccacggcctgctggcg
cccaagggcaagcaccaaggcgacctgcccaacctctacgtggcgcaggacggcacggtg
cagttcgacatcttttcgcagaacggtctcaccctgaagtcgctgttcgacaaggacggc
tccgcggtggtggtgcacgccaaggaggacgactaccacaccgatccggcgggcgacgcg
ggcggccgcatcgcctgcggcgtggtggagaagacctag

DBGET integrated database retrieval system