KEGG   Myotis brandtii (Brandt's bat): 102253884Help
Entry
102253884         CDS       T02920                                 

Gene name
POLRMT
Definition
(RefSeq) RNA polymerase mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     102253884 (POLRMT)
Mitochondrial biogenesis [BR:myb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    102253884 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2 PPR
Motif
Other DBs
NCBI-GeneID: 102253884
NCBI-ProteinID: XP_014395538
LinkDB All DBs
Position
Un
AA seq 1193 aa AA seqDB search
AEEGTLGGLWGCRRSSSASPCEQDRRRDWGHAELLEVLEARVRQLQADNVSEVRAKLLDV
ARLPEADGSQSPRKVEAGNEDAALGLTSRWAQKLHKEKLVMQKRKQKLEENLQKQARKRQ
LRVEPQLLNRQLAGWLQRWERSTPRSPWEEQLAQLLQEAPKRLSRQEEHDQANRLSKMRY
EAQQQRLLAFLECCVLADQLPLAHHVLVMHHSKSRQQRALTLPMYNTLLLGWARKGSFKE
LVYVFFMMKDAGLAPDLLSYAAALQCMGRLDQDASTIQRCLKQMAQDGLQLQELFTSLPL
CKEDKAVLLRAVRKAEPTFLPPQPPLPSFEVNTSPLLKEIYSTDHPASYPKQHLPLETLK
DLFQQQLSVEMATIVTVDSVEKAPSLTEEVLQARKTLQELRTRWEAELCLALQQTKAREA
QAAREGRPSLFPYLCLLSEGELTQLMLQTLQVLSQQGESLLSLAQELGMRIFNRHVVQRK
QLNDEVQALQERYFKYLHLLASDTQVVMSRLPRQHWEALGTTEASQDQPWPLTVVVQLGK
QLAEVLVQTVKMPSNLAQQQDTQKLIPVLYHVYSFQSFRQIGILKPHPAFIQLQETAAER
TMTFESAEVPMLCPPLPWTSPHSGAFLLSPTKLMRSLEGTIQHQRLLEGCPPTELHGALD
ALTQLGNCAWRVNGRVLDLVLTIFNAKGCPRLGVPSPASEAPRPSKHRLPANASPERKTE
LRRELARCLKVAREMHSLRTDALYRLSLAQHLRHRVFWLPHNMDFRGRTYPCPPHFNHLG
SDLARALLEFAQGRPLGPHGLNWLKIHLVNLTGLKKRESLQARLAFADEIMDDILDSADQ
PMTGRKWWMEADEPWQALACCMEIARAVRAPNPAAYISHFPVHQDGSCNGLQHYAALGRD
SVGAASVNLVPSDVPQDVYSSVAAQVEVFRSQDAERGVQVAKVLEGFISRKVVKQTVMTV
VYGVTRYGGRLQIEKRLRELSDFPQEFVWQASHYLVRQVFNSLQEMFSSTRAIQRWLTES
ARLIARSGLAVEWVTPLGIPIIQPYHHDSKVSISGGIQSLTFCSSGDTNQKPNTLKQKNG
FPPNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCFWTHAADVAIMNQVCREQFVRLHSQP
ILHDLSRFLVERYCSGPRSTNAQVAKLQEMLLSVPKTGTFDLDQVKHSTYFFS
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
gccgaggaagggaccctgggtggcctatggggctgcagaaggagctcgtctgccagccct
tgtgaacaagaccgccggagggactggggccacgcggagctgctggaggtgcttgaggcc
agagtgcggcagctgcaggctgacaatgtttcagaggtgagggcgaagctgttggatgtg
gctcgactcccagaggccgatggctcccagtcacccaggaaggtggaggcaggaaacgag
gatgctgccctggggctcaccagccgctgggcacagaagttgcacaaggagaagctcgtg
atgcagaagcgcaagcaaaagctggaggaaaacctgcagaagcaggcccgcaagcgtcag
ctgcgtgtggagccccaactgctgaatcggcagctggcaggctggctgcagcgttgggaa
cgcagcacccccaggagtccctgggaggagcagctggcccagctgctacaggaggcccct
aagaggctgagccgccaggaggagcatgatcaggcgaataggctctccaagatgcggtac
gaggcccagcagcagaggcttctggccttcttggagtgctgcgtgcttgcggaccagctg
cccctcgcccaccacgtgctggtcatgcatcacagcaagtcccggcagcagcgggcactc
accctgcccatgtacaacacccttctgcttggctgggctcgcaagggctccttcaaagag
ctggtttacgtgttcttcatgatgaaagatgccggcctcgccccagacctgctgtcctat
gcggccgccctgcagtgcatggggcggctggaccaggatgccagcaccatccaaaggtgt
ttgaagcagatggcccaggatggactgcagctgcaggagctcttcacgagcttgccactg
tgcaaggaggacaaggccgtactcctgagggctgtgcgcaaggctgagcccaccttctta
cctccgcagccgcccctgccctcgttcgaggtcaacacctccccactgctcaaggagatc
tacagcacggaccaccctgcgtcctacccaaagcagcacctacccttggagacgctgaag
gacctgtttcagcagcagctcagtgtggagatggccaccattgtcactgtggactccgtg
gagaaggccccgtcgctgaccgaggaggtcctgcaagcgcgaaagaccctgcaggagcta
cgcacccgttgggaggcagagctgtgcctggcgctgcaacagacaaaggctagagaggcc
caagctgcccgcgagggccgcccctcactcttcccgtacctgtgcctgctcagcgagggg
gagctgacgcagctgatgctgcagaccttgcaggtgctgtcccagcagggagagtcactt
ctctccctggcacaagagctgggcatgcgcatcttcaaccgacatgtggtgcagaggaag
cagctcaatgatgaggtgcaggcactgcaggagcgctatttcaagtacctacacctgctg
gcatcggacacacaggtggtaatgtcccgtttgccacggcagcattgggaggcactgggg
acaactgaggcctcccaagaccagccctggcccttgactgtggtggtgcagctgggcaaa
cagctggctgaggtgcttgtgcagacagtgaagatgcccagcaacctggcccagcagcag
gacacccagaagctcatccccgtcctctaccatgtgtactccttccagagctttcgccag
attgggatcctgaagccacatccagccttcatacagctgcaggaaactgcggccgagcgc
acaatgacctttgagtcagccgaagtgcccatgctgtgcccgccactgccctggacttcg
ccacactcaggtgccttcctgctgagccccaccaagctgatgcgctctttggagggcacc
atacagcaccagcgcctgctggagggctgcccacccactgagctgcatggtgccctggat
gccctcacccagctgggcaactgtgcctggcgtgtcaatgggcgagtgctggacctggtg
ctaaccatcttcaatgccaagggctgcccccgcctgggcgtgccatcccctgcctctgag
gcaccccgcccatccaagcaccgcctgccagccaatgcctctccagagcgcaagacggaa
ctgcggcgggagctggcccgctgcctgaaggtggcgcgggagatgcatagtctgcggacc
gatgcgctctaccgcctctcgttggcccagcacctgcggcaccgtgtcttctggctgcct
cacaacatggacttccgaggacgcacctacccctgcccaccccacttcaaccacctgggc
agtgacctggcacgcgccctgctggagtttgcccagggccgacctcttggcccccatggc
cttaactggctcaagattcacttggtcaacctcaccgggctcaagaagcgtgagtcactg
caggcacgcctggcctttgctgatgagataatggacgacatcctggactcagccgaccag
cccatgacgggccggaagtggtggatggaggcagatgagccctggcaagccctggcctgc
tgcatggagattgctcgggctgtgcgtgccccaaaccctgccgcttacatctcccatttc
cccgttcaccaggatggctcctgtaatggcctgcaacactatgctgccctgggccgggac
agcgtgggggctgcctctgtcaacctggtgccctcagacgtgccacaggatgtgtacagc
agcgtagcagcacaggtggaggtgttccgcagccaggacgctgagcggggtgtgcaggtg
gccaaggttttggagggcttcatcagccgcaaggtggtcaagcagacggtgatgaccgtg
gtgtatggggtcacccgctacgggggccgcctgcagatcgagaagcgcctccgggagctc
agcgacttcccccaggagttcgtgtggcaggcctctcactaccttgtgcgccaggtgttc
aacagtcttcaggaaatgttctcaagcacgcgggccatccagcgctggctgacggagagt
gcccggctcattgctcgatccggcttggctgtggagtgggtcacccccctgggtatcccc
atcattcagccctatcaccacgactccaaggtgtcgatcagtggagggatccagagtctc
accttctgcagcagtggggacaccaaccagaagcccaacacactgaagcagaagaatggt
ttcccacccaacttcatccactccctggactcctcacacatgatgcttacagccctgcac
tgttacaggaagggcctgacctttgtctccgtgcacgactgtttctggacccatgcagct
gatgtcgccatcatgaatcaggtatgccgtgagcagttcgttcgcctgcacagccagccc
atcctgcacgacctgtccaggtttctggtggagcggtactgctctggccccaggtccacc
aatgcccaagttgccaagttgcaggaaatgctactgtcagtacccaagacagggaccttc
gacctggaccaggtaaagcactcgacgtacttcttcagctga

DBGET integrated database retrieval system