KEGG   Myotis brandtii (Brandt's bat): 102259554Help
Entry
102259554         CDS       T02920                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102259554 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102259554 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102259554 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102259554 (PTGS1)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102259554 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 625 aa AA seqDB search
MGREGRAGPARAPAELGAREVPAVCILLRCTMNRWSLSFWFPLLLLLLPADAREPSPVNP
CCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPDLWTWLRNSLRPSPSFTHFLLTH
GRWFWEFINATFIRDMLMRLVLTARSNLIPSPPTYNVAHDYISWEAFSNLTYYTRVLPSV
PQDCPTPMGTKGKQQLPDPQLLSRRFLLRKKFIPDPQGANLMFAFFAQHFTHQFFKTSGK
MGAGFTKALGHGVDLGHIYGDNLDRQYQLRLFKDGKLKYQMLGGEMYPPSVEEAPVLMHY
PKGIPPKSRMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLI
LIGETIKIVIEEYVQQLSGYFLQLKFDPELLFSVQFQYQNRIALEFNHLYHWHPLMPDSF
TVGSQDYSYEQFLFNTSILVDHGVEALVDAFSRQSAGRIGGGRNIDHHILHVAMDVIKES
REQRLQPFNEYRKRFGMKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPN
SIFGESMIEIGAPFSLKGLLGNAICSPEYWKSSTFGGEMGFNIVKTATLKKLVCLNTKTC
PYVSFHVPDPLQDDEPGVERPSTEL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggtagggaggggcgggccgggccggccagagctcccgcggagttaggggcacgcgag
gttccggcagtttgtatcttgctccgctgcaccatgaaccgatggagtctttcgttctgg
ttcccactgctcctgctgctgctgcccgcagacgcccgggagccctcgccggtgaacccc
tgttgctactacccatgccagcaccagggcatctgtgtccgctttggccttgaccgctac
cagtgtgactgcacccgcacgggctattctggccccaactgcaccatccctgatctgtgg
acctggctccggaattcattgcggcccagcccctctttcacccacttcctgctgacacac
gggcgctggttctgggagtttatcaatgccaccttcatccgtgacatgctcatgcgcctg
gtactcacagcgcgttccaaccttattcccagcccccccacctacaacgtagcacatgat
tacatcagctgggaggccttctccaacttgacctattacactcgtgttctgccctccgtg
ccccaagactgccccacacccatggggaccaaagggaagcagcagctgccagatccccag
ctcctgagccgtcgcttcctgctcaggaagaagttcatacctgacccccaaggtgccaac
ctcatgtttgccttcttcgcccaacacttcacccaccagttcttcaaaacttctggcaag
atgggtgctggcttcaccaaggccttgggccatggggtagaccttggccacatttatggg
gacaatctggaccgtcagtatcagctgcggctctttaaggatgggaaactcaagtaccag
atgctgggcggagagatgtacccgccatcggtggaagaggcgcctgtgttgatgcactac
ccaaagggcattccgcccaagagccggatggctgtgggccaggaggtgtttggactgctt
cccgggctcatgctttatgccacgctctggctgcgcgaacacaaccgcgtgtgtgacctg
ctgaaggctgagcaccccacctggggagatgaacagctcttccagacggcccgcctcatc
ctcataggggagaccatcaagatcgtcatcgaggagtacgtgcagcagctgagcggctac
ttcctgcagctcaagttcgacccggagctgctgttcagcgtccagttccagtaccagaac
cgcatcgccttggagttcaaccatctctaccactggcacccgctcatgcccgactccttc
acggtgggatcccaggactacagctatgagcagttcctgttcaacacctccatactggtg
gaccatggggtggaggccctggtggacgccttctctcgccagagcgctggccggattggt
ggcggtaggaacatagaccaccacatcctgcacgtggccatggacgtcatcaaggaatct
cgagagcagcggctgcagcctttcaatgagtaccgcaagaggtttggcatgaagccctac
acctctttccaggagttcacaggagaaaaggagatggcagctgaattggaggagctatat
ggagacattgatgccttggagttctacccgggactgcttcttgagaagtgccatccaaac
tccatctttggggagagtatgatagaaattggggctcccttttccctcaagggcctctta
gggaatgccatctgttctcccgagtactggaagtcaagcacatttggtggtgagatgggc
ttcaacattgttaagacggccacactgaagaagctggtttgcctcaacaccaagacttgt
ccctatgtttccttccacgtacctgatcctctccaggatgatgagcctggtgtggagcgg
ccatccacagagctctga

DBGET integrated database retrieval system