KEGG   Myotis brandtii (Brandt's bat): 102259598Help
Entry
102259598         CDS       T02920                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00590  Arachidonic acid metabolism
myb01100  Metabolic pathways
myb04064  NF-kappa B signaling pathway
myb04370  VEGF signaling pathway
myb04625  C-type lectin receptor signaling pathway
myb04657  IL-17 signaling pathway
myb04668  TNF signaling pathway
myb04723  Retrograde endocannabinoid signaling
myb04726  Serotonergic synapse
myb04913  Ovarian steroidogenesis
myb04921  Oxytocin signaling pathway
myb04923  Regulation of lipolysis in adipocytes
myb05140  Leishmaniasis
myb05165  Human papillomavirus infection
myb05167  Kaposi's sarcoma-associated herpesvirus infection
myb05200  Pathways in cancer
myb05204  Chemical carcinogenesis
myb05206  MicroRNAs in cancer
myb05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102259598 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102259598 (PTGS2)
   04064 NF-kappa B signaling pathway
    102259598 (PTGS2)
   04668 TNF signaling pathway
    102259598 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    102259598 (PTGS2)
   04657 IL-17 signaling pathway
    102259598 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102259598 (PTGS2)
   04913 Ovarian Steroidogenesis
    102259598 (PTGS2)
   04921 Oxytocin signaling pathway
    102259598 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    102259598 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102259598 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102259598 (PTGS2)
   05206 MicroRNAs in cancer
    102259598 (PTGS2)
   05204 Chemical carcinogenesis
    102259598 (PTGS2)
   05222 Small cell lung cancer
    102259598 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102259598 (PTGS2)
   05165 Human papillomavirus infection
    102259598 (PTGS2)
   05140 Leishmaniasis
    102259598 (PTGS2)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102259598 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102259598
NCBI-ProteinID: XP_014396929
UniProt: S7PLU6
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLVRALLLCAALALRAAANPCCSNPCQNRGVCMSVGFDQYTCDCTRTGFYGENCSTPEFM
TRIKLLLKPTPNTVHYILTHFKGVWDIINNIPFLRNAIMKYVLTSRSDLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSDMILDKFMIRREFIPDPQGT
NLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKLKY
QVIDGEVYPPTVKDTQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFHIDDQEYSYQQFLYNNSLLMEHGLTQFVESFSKQNAGRV
AGGRNLPVAVRKVAKASIEQSRHMRYQPLNEYRKRFRMKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEEPRPDSIFGETMVELGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPSTSFSVGDPQPTKTVTMNATPSHSGLEDINPTVLLKGR
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccgcgccctgctgctctgcgcagccctggctctccgcgctgcagcaaatcct
tgctgttccaacccatgccaaaaccgaggtgtctgtatgagtgttggatttgaccagtat
acgtgtgactgtactcgaacaggattctacggggaaaactgctcaacacctgaatttatg
acaagaataaaattactcctgaaacccactccaaacacggtgcactacatacttacccac
ttcaagggagtctgggacattatcaataatattcccttcctgagaaatgcaattatgaaa
tatgtgttgacatccagatcagatttgattgacagcccaccaacgtacaatgcacactat
ggctataaaagctgggaagccttttcgaatctctcctattataccagagctcttcctcct
gtggctgatgactgccctactcccatgggtgtgaaagggaagaaagagcttcctgattca
gacatgatcctggataaatttatgataagaagagagttcattcctgatccccagggcaca
aatttgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcactaaaggactgggtcatggggtggatttaaatcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaactgaaatat
caggtaattgatggagaggtatatcctcccacagtcaaagatacccaggctgagatgatc
tacccgcctcatgtccctgaacacctgcggtttgccgtgggccaggaggtgtttggtctg
gtgcctggtctgatgatgtatgccacaatttggctgcgtgaacataacagagtgtgtgat
gtgcttaagcaggagcatccagaatgggatgacgagcggttgttccagacaagcaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgcatcgctgctgagtttaacactctctaccactggcatccccttctgcctgacacc
tttcacattgatgaccaggagtacagctatcaacagtttctctacaacaattctttatta
atggaacatgggcttacccagtttgtcgaatcattcagcaagcaaaatgccggcagggtg
gctggcggtcggaatcttcccgttgcagtacgaaaagtagccaaggcctcaattgagcag
agcagacacatgagataccagcctctgaacgagtaccgcaaacgctttcggatgaagccc
tatgaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacattgacgccatggagctgtaccctgcccttctggtagaagagcctcgccca
gatagcatctttggtgagaccatggtagaacttggagcccccttttccttgaaaggactg
atgggcaatcctatatgttctcctcactactggaagcctagcacttttggcggtgaagtg
ggttttaaaatcatcaacactgcctccattcagtctctcatctgcaataacgtgaaaggc
tgcccctctacttcgttcagtgttggggacccacagcccaccaagacagtcaccatgaat
gcgaccccctcccactctggactggaggatatcaatcctaccgtactactaaaaggacgt
tcagctgaactgtag

DBGET integrated database retrieval system