KEGG   Myotis brandtii (Brandt's bat): 102260180Help
Entry
102260180         CDS       T02920                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:myb00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102260180 (PRSS2)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102260180 (PRSS2)
   04974 Protein digestion and absorption
    102260180 (PRSS2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102260180 (PRSS2)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102260180 (PRSS2)
Peptidases [BR:myb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102260180 (PRSS2)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102260180 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAFSTDDDDKIVGGYTCQENSVPYQVSLNDGSHLCGGSLINDQWVVS
AAHCYMPRIQVRLGEHNIEVEEGNEQFINSAKVIRHPRYNSWTLDNDIMLIKLSSPAVIS
SRVSTVSLPTSCAPAGTQCLISGWGNTLSSGINYPELLQCLDAPLLAQEQCEAAYPGQIT
DNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQKNKPGVYTRVCNFVDWIQ
ETMAANN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagccgctgttgctttctccactgatgac
gatgacaagatcgtcgggggctacacctgccaggagaattctgtcccctaccaggtgtcc
ctgaacgatggctcccacttatgtggtggatccctcatcaatgaccagtgggtggtgtct
gcggctcactgctacatgcctcgcatccaggtgaggctgggagagcacaacatcgaggtc
gaggaggggaatgagcagttcatcaactctgccaaggtcatccgccacccccgctacaac
agctggaccctggacaatgacatcatgctgatcaagctgtcctcccctgcggtcatcagt
tcccgggtgtccactgtctccctgcccacctcctgtgcaccagctggcacccagtgtctc
atctccggctggggcaacaccctgagctctggcatcaactaccctgagctgctgcagtgc
ctggatgccccattgctggcccaggagcagtgtgaagccgcataccccggacagatcacc
gacaacatggtgtgcgccggcttcctcgagggtggcaaggattcctgccagggtgattct
ggtggccctgtggtctgcaacggagagcttcagggagttgtctcctggggctatggctgt
gcccagaagaacaagcctggtgtctacaccagggtctgcaacttcgtggactggattcag
gagaccatggctgccaacaactaa

DBGET integrated database retrieval system