KEGG   Mycobacterium abscessus 4529: NF90_05945Help
Entry
NF90_05945        CDS       T03535                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
myc  Mycobacterium abscessus 4529
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NF90_05945
Enzymes [BR:myc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NF90_05945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1233137..1234918
Genome map
AA seq 593 aa AA seqDB search
MSDATSPSGSSGPTYTFLGPEARSLNWERLGSEQFDVIVIGGGVVGAGSALDAATRGLKV
ALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVQEALRERELSLSTLAPHLVKPLPFL
FPLTNRWWERPYVAAGIFLYDQMGGAKSVPAQKHLTRAGALRLAPGLKRNSLIGGIRYYD
TVVDDARHTMTVARTAAHYGAVVRASTQVVSLLREGDRVTGVLVRDTESGAETEVRGHVV
INATGVWTDEIQALSKTRGRFRVTASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGN
HWIIGTTDTEWNLDLAHPAATKVDIDYILDHVNTVLATPLTHNDIDGVYAGLRPLLAGEN
DDTSKLSREHAVAVAAPGLVAIAGGKYTTYRVMASDAVDMASEFVPARVAPSITEKVPLL
GADGYFALINQTEHVGETYGLHPYRVRHLLDRYGSLIGEVLACAGTDHSLLQPITKAPMY
LKVEALYAVAAEGALHLEDILARRMRIAIEYPHRGVECAQEVAELVAPVLGWSAEDIVRE
VDTYRARVDAEVRSQRQPDDASADALRVAAPEARSFIVEPVTETGTVLSPATK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgcaaccagcccgtcggggtcgagtggacccacatacacgttccttgggccc
gaagctcgttcactgaattgggagcgcctgggatccgagcagttcgatgtgatcgtcatc
ggcggcggtgtcgtgggcgccggttcggcgctggacgcggcaacccgtggcctcaaggtc
gcgctggtagaggctcgtgactttgcgtcgggaacctcgagccgctcgtcgaagatgttc
cacggcggtctgcgctacctggagcagctcgaattcggattggtgcaggaggcgttgcgt
gagcgggagctgtccctctcgacgctggcaccgcacctggtcaagccgctgccgttcctg
ttcccgttgaccaacaggtggtgggagcggccgtacgtggcggcgggtattttcctgtac
gaccagatgggtggtgcgaaatctgttcctgcccaaaagcatctgacccgtgcgggcgcg
ctgcggctggcaccggggctcaagcgaaattcactcatcggcgggatccggtattacgac
acggtggtcgacgacgcccgtcacaccatgaccgtggcacgtacggccgcccactatggc
gcggtggtgcgcgcctccacacaggtggtctcgctgctgcgtgagggtgaccgtgtcacc
ggtgtgctggtgcgggatacggagagcggtgccgaaaccgaggttcgcgggcatgtcgtc
atcaacgcgaccggagtgtggaccgacgagatccaggcgctgtccaagacacgagggcgt
ttccgggtcacggcatccaagggcgtgcatatcgtggtgccgcgcgacagaatcgtcagc
gaggtcgcgatcatcctgcgtaccgagaaatcggtgctgttcgtgattccgtggggcaac
cattggatcatcggaaccaccgataccgagtggaatctggacctggcgcatcccgctgcc
accaaggtcgacatcgactacatcctggaccatgtgaacaccgtgttggcaacaccgttg
acgcacaacgatatcgatggggtgtacgcagggctgcggccattgctggcgggcgagaac
gacgacacgtccaagctgtctcgcgagcacgcggtcgccgtggcggctcctggcctggtg
gccatcgcgggcggcaagtacaccacgtatcgagtgatggcgtccgatgccgtagacatg
gcaagcgaattcgtgccggcacgggtggctccctccatcacggagaaggtgccactgctg
ggtgccgacggatacttcgcgctgatcaaccagaccgagcatgtgggggagacctacggt
ctgcatccctaccgcgtgcggcatctactggaccggtacggttcgttgatcggcgaggtg
cttgcctgtgcgggcacggaccatagcctgctgcaaccgattaccaaggcgcccatgtat
ttgaaggttgaggcgctctatgcggtggcggcagagggcgctctgcacctggaggacatt
ctggccaggcgcatgcgtatcgccatcgaatacccgcatcgcggtgtcgagtgtgcccag
gaagtcgccgagctggtggcacccgtgctggggtggtcggcagaggacatcgtgcgtgaa
gtggatacgtatcgggcgcgggtcgatgccgaagtgcgctcacagcgtcagcctgacgac
gcctcggcggacgcgctgcgagtggccgcgcccgaagcacggtcgttcattgtcgagccg
gtgaccgaaacaggtaccgtgctctcgcccgccaccaagtag

DBGET integrated database retrieval system