KEGG   Mycobacterium abscessus 4529: NF90_19185Help
Entry
NF90_19185        CDS       T03535                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
myc  Mycobacterium abscessus 4529
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:myc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NF90_19185
Enzymes [BR:myc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     NF90_19185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3915830..3917290)
Genome map
AA seq 486 aa AA seqDB search
MHTNEIQSFVGGRWISGGGQAVISVCPAFPDRVIAEGLAAGPAEFDEAAAAARAAQPGWA
AMSLHERGAILSHAAAVVDRNADAWGLELAAEEGKTKAEGIAEVRRAAQILRYYGNEGDR
QTGEIFSSPRRGEHILVTRKPLGVVGVITPFNFPIAIPAWKIAPALVYGNAVLWKPASTV
PLLAMRLAQAFDAAGLPAGVLNLVVGDTGVGDAMVNDSRVDAVTFTGSTGVGRRIAAAGA
ARGIPVQAEMGGKNAAVVLDDADVDLAVEQVLLGAFRSTGQKCTATSRLVLTEGIADAFL
SLLKDRADALVVGDPTADDTQMGPVVSESAFGAITAGIGSAVAQGAVTLAGGHGYGDGPL
AAGYFIAPTIMELGTGAVDLWTEELFGPVLAVRRAADTEEAFRLANDSEYGLSAAIFTKD
LTRALSAVDHVDVGILHVNSESAGADPHVPFGGAKKSGLGPKEQGRAAREFFTHTTTVYL
RGGEAL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcataccaatgagattcaaagttttgtgggcggccggtggatcagcgggggcggccag
gcggtgatcagcgtgtgccccgcatttcctgaccgggtgatcgccgaagggctggctgcg
gggccggcggagttcgatgaggccgccgcggcggcgcgcgcggcgcagcccggttgggcc
gccatgtccttgcacgagcggggcgcgatattgtcgcacgctgccgcggttgttgaccgt
aacgccgatgcctggggcctggaacttgctgcggaggaggggaaaaccaaggcagagggc
atcgcggaggtacggcgggccgcgcagatcctgcggtactacggcaatgagggcgaccgg
cagaccggggagatcttcagttcaccgcgacgcggtgaacacatcctggtgacccgcaag
cccctcggggttgtgggcgtaataaccccattcaattttcctatcgccataccggcctgg
aagatcgcccccgcattggtatatggcaacgccgtgctgtggaagccggcgagcacggtc
ccgctgctggccatgcgtcttgcccaggcattcgatgccgccgggctgccagctggtgtg
ttgaacctcgtcgtcggggatacaggtgtcggtgatgccatggtgaatgacagccgagtc
gatgccgtcacgttcacaggttcaacgggcgtcggccggcgcattgcggcggcaggggcg
gcgcggggcataccggtccaagcggaaatgggtggcaagaacgccgccgtcgttctcgat
gatgccgacgtcgacctcgccgtggagcaggtactgctgggagccttccgctccacggga
caaaagtgcaccgccacgtctcggctggtactcaccgagggcatcgcggacgccttcctg
tcgttgctcaaggatcgcgcggacgcgctggttgtcggtgatcccaccgcagacgacacc
caaatgggcccggtggtcagcgagtccgcgttcggcgcgatcaccgcggggatcggcagc
gcggtcgcacagggtgcggtcacccttgccggtgggcacggctacggggacggccccctg
gccgccggctacttcatcgcgccgaccatcatggaactcggtacgggagcggtggacctc
tggaccgaggaattattcggcccggttttggcggtgcgccgcgccgcagacaccgaggag
gcgttcaggttggcgaacgacagtgagtacggtttgtccgcagcgatattcacaaaagac
ctcacccgagctttgtcggcggtcgaccacgtggacgtgggcatcctgcatgtgaattcg
gaatccgccggcgccgacccgcatgttccgtttggaggcgccaagaagagcgggctgggc
cccaaggaacagggccgggccgcgcgggagttcttcacccacaccaccaccgtgtatctg
cgcggcggggaggcactgtga

DBGET integrated database retrieval system