KEGG   Myotis davidii: 102765299Help
Entry
102765299         CDS       T02992                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
myd  Myotis davidii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:myd00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102765299 (SETDB2)
Enzymes [BR:myd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102765299 (SETDB2)
Chromosome [BR:myd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102765299 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102765299 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 693 aa AA seqDB search
MELEDDGKVDIIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEATINNNLTLIKDHK
SLTENEQENKSGSLPSTSYEDFVPEDSTVLSIKNEEFPPLENKAADFREKESSLNLSYKS
HDCSSTCLMKMLLTFKGENPLQLPITCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNMEE
VFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSVLDISNGVELVPISFCNEIDSR
KLPHFKYRKTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQMTARNAEIYSLSRDK
IAVGYKYKRLQRHIPTGIYECSLLCKCNRQMCQNRVVQHGLQVRLQVFKTEKKGWGVRCL
DDIDRGTFVCTYSGRLLSRYNTEKRDTIGENREEDNIMKNTFSKKRKIEVADCEVEAIPL
KLETCPRSAKSEECPPKFNNNPEEPVIEMKYNNISRIQCHSVIRTPEAKIAIIQPDGKKM
GFASSESVTFEDNDGFKPTQVHQSSKAKEMKTDSSSNQVEDSEDNLLIDSDVIDITKGRE
ETSSGGISNHATTLDNQDIMKKFEVQMLKPQEENSPACQNHYVFCNKELPGETKNNTSCE
SLKFSKGRVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVAFFTNRYVKAR
TELTWDYGYEPGTVPDKEILCQCGVNKCRKKIL
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggaactggaggatgatggaaaagtggacatcatatttgagcaagtgcaaaatgtgctg
cagtcactgaagcagaagatcaaagatgggtctgccacaaataaagagtacattcaagca
atgattctagtgaatgaagcaactataaataacaatttaacattgataaaagatcataaa
tctttgactgagaatgaacaggaaaacaaatcaggttcattgccatctacatcatatgaa
gactttgttccagaagacagtacagttctatctataaaaaatgaggaatttccccctctg
gaaaataaagctgcagactttagagaaaaagaatcatctttgaatttatcttacaaaagt
catgactgctctagtacctgtctgatgaaaatgctactaaccttcaagggagaaaaccct
ctgcagctaccaattacgtgccacttccaaagacgacatgcaaagacaaactctcattct
tcagcgctccacgtgagttataaaaccccttgtggaaggagtctacgaaacatggaggaa
gtttttcgttacctgcttgagacagagtgtaactttttatttacagataacttttccttt
aatacctatgttcagttgactcggaattacccaaagcaagaagaaattgtttctgttctg
gatattagcaatggagtggaattggtgcccatttctttctgtaatgaaattgacagtaga
aagcttccacactttaagtacagaaagactatgtggccacgagcatattatctaaacagc
ttttccaacatgtttactgattcatgtgactgttctgagggctgcatagacataacaaaa
tgtgcatgtcttcaaatgacagcaaggaatgctgagatttactccttgtcaagagataaa
atagccgttggatataaatataaaagactacagagacatatacctactggcatttatgaa
tgcagcctgttgtgcaagtgtaatcgacaaatgtgtcaaaaccgagtagttcagcatgga
cttcaagtgaggctacaggtgttcaaaactgagaagaagggatggggagtacgctgccta
gatgacattgacagagggacatttgtttgcacttactcaggaagattactaagtagatat
aacactgagaaacgtgatactattggagaaaatagagaagaagacaatattatgaaaaat
acattttcaaaaaagaggaaaatagaagttgcagattgtgaagttgaagctatcccttta
aaattggaaacatgtcctagaagtgctaagagtgaagaatgtccacctaagttcaataat
aatccagaagagcctgttatagaaatgaaatataacaatatttcaagaattcagtgtcat
tcagtcattagaactccagaagccaagatagccattattcaacccgatgggaaaaagatg
ggatttgcttcctcagaatctgtcacctttgaagataatgatggatttaaaccaacccaa
gtacatcagagctctaaagccaaagagatgaaaacggactcaagctcaaatcaagttgaa
gattctgaagacaatttgctgattgactcagatgtgatagatataactaaaggtagagaa
gaaacttcatcagggggcataagtaaccacgcaaccacattggataatcaggatattatg
aagaagtttgaggttcaaatgctaaagccccaagaggaaaactctccagcttgtcaaaac
cattatgtcttttgtaataaagagttgccaggtgaaaccaagaataatacttcatgtgaa
tctctcaagttcagtaaaggaagagtgtttttattggatgccacaaaggaaggaaatgtg
ggccgctttcttaatcatagttgttgcccaaatcttttggtacagaacgtttttgtagaa
acacatgacaggaattttccattggtggcattcttcaccaacaggtatgtgaaagcaaga
acagaattaacatgggattatggttatgaacctggaactgtaccagataaagaaatcctc
tgccaatgtggggttaataagtgcaggaaaaaaatattataa

DBGET integrated database retrieval system