KEGG   Mycobacterium sp. EPa45: AB431_06835Help
Entry
AB431_06835       CDS       T03960                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00250  Alanine, aspartate and glutamate metabolism
mye00410  beta-Alanine metabolism
mye00430  Taurine and hypotaurine metabolism
mye00650  Butanoate metabolism
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye02024  Quorum sensing
Module
mye_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mye00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AB431_06835
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AB431_06835
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB431_06835
   00430 Taurine and hypotaurine metabolism
    AB431_06835
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AB431_06835
Enzymes [BR:mye01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AB431_06835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKK26454
UniProt: A0A0G3IHW3
LinkDB All DBs
Position
1448843..1450222
Genome map
AA seq 459 aa AA seqDB search
MPHVKYRSPSIAPAYTGRLSTDPIPSLRLPDEAMEPTAAYRFIHDELMLDGSSRLNLATF
VTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHAENLRDDDAATAVG
VSTIGSSEAVMLGGLALKWRWKARVGDKWKTRTPNLVMGSNVQVVWEKFCRYFEVEPRYL
PMAEDRYVITPEQVLDYVDEDTIGVVGILGTTYTGELEPIADICAALDKLQKEKGLDIPV
HVDAASGGFVVPFLHPDIKWDFRLPRVASINVSGHKYGLTYPGIGFVVWRNADCLPEELV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTHVMQCLSGTARWLSDQLEAC
QHFEVISDGSAIPVVAFRLKGDLGYTEFDVSAALRSYGWQVPAYTMPDGAENISVLRVVV
REGFSADLARSLWADLNAVLGHLDAIQPEGHFTQEHFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgccccacgtcaaataccgatccccgtcgatcgcaccggcatacaccggacgtctgtcc
accgacccgatcccgtcgctgaggctgcccgacgaagcgatggaacccactgcggcatac
cgattcatccacgacgagctgatgctcgacggcagctctcggctcaacctcgctacgttc
gtcaccacctggatggaccccgaggccgagaagctgatggccgagacgttcgacaagaat
atgatcgacaaggacgaatacccagccaccgcggccatcgaatcacgctgtgtggcaatg
gttgccgatctgttccacgccgagaaccttcgtgacgacgatgccgccaccgcggtcggg
gtctccaccatcgggtcgtcggaggcggtgatgctcggcgggttggccctgaagtggcgc
tggaaggcccgggtcggggataagtggaaaacccgcacccccaacctggtgatgggctcc
aacgtgcaggtggtgtgggagaagttctgccgttacttcgaggtcgagccgcgctacctg
ccgatggccgaagaccgctacgtcatcacccccgagcaggtccttgactacgtcgacgag
gacaccatcggtgtcgtgggcatcctgggcaccacctacaccggtgaactggagccgatc
gccgacatctgtgcggccctggacaaactgcagaaggagaagggactcgacatcccggtc
cacgtcgacgcggccagcggcggcttcgtggtgccgttcctgcacccggacatcaagtgg
gacttccggttaccgcgcgtggcgtcgatcaacgtcagcggccacaagtacgggctgacc
tatccgggcatcggattcgtggtgtggcgcaacgccgattgcctaccagaagagctggtg
ttccgggtcaactacctcggcggtgacatgccgaccttcacgctgaacttctcccggccc
ggcaatcaggtggtcggccagtactacaacttcctgcggctgggccgggccggttatacc
catgtgatgcaatgcctttccgggacggcacggtggctgtccgaccagctggaggcttgt
cagcacttcgaggtgatctcggacggctcggcgatcccggtggtggcgttccggctcaag
ggtgacctcggctacaccgagttcgacgtgtcagcagcgctgcgctcctacggctggcag
gtgcccgcctacaccatgcctgatggcgcggagaacatctcggtcctgcgcgtggtggtc
cgtgaaggcttctccgccgatctggcccgctcgctgtgggcggacctcaacgccgtgctc
ggccacctcgacgcgatccagcccgagggtcacttcacacaggaacacttcgcgcactga

DBGET integrated database retrieval system