KEGG   Mycobacterium sp. EPa45: AB431_08580Help
Entry
AB431_08580       CDS       T03960                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mye  Mycobacterium sp. EPa45
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1816232..1817842
Genome map
AA seq 536 aa AA seqDB search
MNGAPAIRPKFDTLTEMLDAAAHSGQSLFFVDRNEFDTEVPMADIRRQARAVAAGLSSAG
VRPGDRVALVLPTGPEFVASFFGVLYAGAIPVPLYPPVRLGKLDEYRHRTAAMLQAVQAV
LVITEERIRPLLEATGVRCRTATELNGTWHRDIEVSADDLALIQFSSGTTHDPKPVALTH
RNLLYNLGAIADYFAAAGMPDQVGVTWLPLYHDMGLIGNLLTAFYLPRPLVLLPPDLFLA
VPAAWLRAVSRHRGTVTAAPNFAFGLCLKRIRDDELADVDLSSWQLCLNGAELTNADVQR
RFSERFEPWGFDAQAFTPVYGLAEASLAVTFKPPGTVFRTFDLDDRELVSTGRPLAGVEV
EIRDDDSRRLPDGEVGHIFVRGASVMSGYFGRDDLTEHVLIGGWLDCGDLGFVHDGELFV
CGRTKETVIIRGANHAPQDFEAALDGLTGVRTGCAVAVGYLPADAEDEALAMLVETTADA
PDGLASDVAARVLQHTGIAVGHVELLAPGTLPRTSSGKMRRLEARSQWLAGTLSPC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgctccggcgatccggccgaagttcgacacgctcaccgagatgctggacgcc
gcagcgcacagtggccagagcctgttcttcgtcgatcgcaacgagttcgacaccgaagtt
ccgatggccgacattcgccggcaggcgcgtgcggtcgcggccgggttgagtagcgccggt
gtccggcccggtgaccgtgtggccttggtgctgcccaccggtccggaattcgtcgcctcc
ttcttcggcgtcctgtacgcgggtgcgatcccggtgccgctgtacccgccggtgcgactg
ggcaagctcgacgagtatcgccaccgcaccgccgcgatgctgcaagcggttcaggccgtc
ctcgtgatcactgaggagcgcattcggccactgctcgaggccaccggggtgagatgtcga
acggccaccgaactcaacgggacatggcaccgtgacatcgaggtgtccgccgatgaccta
gcgttgatccaattctcctcgggcaccacccatgaccccaaaccggtagcgctgacccac
cgcaatctgttgtacaacctcggggcgatcgcggactacttcgccgcggcgggcatgccg
gaccaggtcggcgtcacctggctgccgctgtatcacgacatgggcttgatcgggaacctc
ctgacggcgttctaccttccacgaccgctggtgttgctgccacccgatttgttcctggcc
gtgccggccgcatggttgcgcgccgtctctcggcaccgcggaaccgtcaccgccgcaccg
aatttcgcgttcggcctgtgcctgaagcggattcgcgatgacgagctcgccgatgtcgac
ctcagttcgtggcagctgtgcctcaacggcgccgagttgaccaacgccgacgtgcagcgt
cggttcagtgagcgcttcgagccgtggggattcgatgcgcaagcgttcacaccggtgtac
ggcctggccgaggcgtcattggcggtgacgttcaagccaccgggcacagtgtttcgaacc
ttcgatctcgatgacagagaattggtgagcacgggccgtccgctggccggcgtcgaagtg
gagatccgcgacgacgattcccggcggctgcccgacggcgaggtagggcacatcttcgtt
cgcggagccagcgtgatgtccggctacttcggccgcgacgacctcaccgagcacgtcctg
atcggcggctggctggattgtggcgacctcggattcgtccacgacggtgagcttttcgtg
tgtggtcgcaccaaggagacggtgatcatccgcggcgcgaaccacgcaccccaggatttc
gaggccgcgctcgacgggctcaccggtgtccgcaccggatgtgcggttgcggtgggttac
ctgcccgccgatgcggaggacgaggcgctggcgatgctggtcgagaccaccgccgatgcg
ccggacggcttggccagtgacgtcgctgcccgggtgctgcagcacaccggcattgccgtc
ggccacgtcgagctgttggcgcccggcacattgccgcggacatcgagtgggaagatgcgc
cggctcgaagcgcgttcgcagtggctggcgggaactctgtcaccgtgttag

DBGET integrated database retrieval system