KEGG   Mizuhopecten yessoensis (Yesso scallop): 110440609Help
Entry
110440609         CDS       T05079                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like isoform X1
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:myi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110440609
Enzymes [BR:myi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110440609
Chromosome [BR:myi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110440609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1866 aa AA seqDB search
MELKLHSPAGAEAVSYTWPLSNSDGKEGANEIIETIRWVSEDFPELETALDNNILQDYDV
RSFESMKQLCDKYNRTIDSILQLWKGTSRPQKIKERPSTGLLKHILQQCYDHAVKDPERL
NQYEPFSPEVYGETSFDLVDQMIKSINFSETDYFIDLGSGVGQVVLQVAAATSCKMCYGI
EKAEYPAKYAEDMEKQFKRWMKWYGKKFSNYQLDKGDFLCDEMVEKINNATVIFVNNFAF
GPQVDHQLKLRFANMKEGAKIVSSKAFCPLNFRITDRNLSDIGTIMHVAELSPLSGAVSW
TGKAFTYFVHTIDRTLLEKYFLRMKNPKLKDDEDVRRDRRGRPIHLREKHTCCSGHGDSK
PHEELKNGALKKKIRALEVNKNEMPALNVIKDHSYQAARNLDFDSASNASTATSMSGTAE
EIAQVMGGPTTRRQWSECLSKPAPEVASPEHPPTFREESDENAVVVDIPKKMTRTRAAKT
ASKRLRNGQLRKEPHTAVGEVSSTPPVTGRKKSNLGSRARANKNKEKEKVLGLDSLNLLH
THTLMSTAASPESNDKWNDRSMVSMTNAFFKPSTQAQTVSSLETEPALQRLLDLFRHQYN
KFLAYMQTPDYKSNLLLQIDQEREKQSCLKSRVAYLEKQIYGLQKDSVGQLKARMSEINF
VSQLGIDTDCPADFLTKAKSIVQEHKELEGQMGTLKGQVASLEADRRKLVEVQQQVLLEK
TGGINGKRNGFHKPTVQENVLKEINNSYSQKKNLITKVQELEVNLNDLQQHKLARLDDDI
KGDDSPSQDSGISLTPTVPPPQSPDEAATTDMSGKPLGLYFQSTTDKSQDQTNVSADTKQ
IKIVTGAISGFRQTSPCNNLLDHKPSAKDSGTLGVSASSHENHSSIKSSPYMSSSLSSSS
SPPPPRKPGDGYTPGALSIRILLEASGEQVRQRNRGEIASRLAGYKSGVVKDLHQDSTGK
LEYERIKKEAKPAHLIDQVVHMALSSQPTDSNQGNVLVTHNKKVKLSNGVKSSAKGVALE
SNRPTLPVSIPLDQLQKEQLRQKILNRTGPSKHEAGDVTSQVSKQSSKSDHDAGFYSPIS
RPSSRGSTTESADEPGCDVTASHSYSPATASNSPRGPGYSSSRHRTDSKAKTPARVPVNN
HFVENMSTQTKSNNLLHGRGQRVHTDQQKFNLAEALLQMSEVRSNKPVSPRQALPSVPTK
CGDSSKSPKMRYTLESYQAADRKRLKRKKTEILENDNKKMALSSNAVSYTPSHGVLDSML
GHTSGISSFSSPDSGMSTPHVQSPLFPTARPKLKSHYNLQNSSAKDSPSKNWQAQISSGF
DALVALASSELDKNREIRRKSLEGQSPSPRKSQVIPTKQHVSLRDSLRGRDNDKRRGPKT
PPGSPPRSKRGPRTPPGSPHSQKKGVKGRRNNSYSSSRSRSCSLSRTSSHTQSSRSSSRS
SCYSSSRSRSRSRSSSSSRSSGSGRHRNTKISLKKASETVNKPVVTHPVINSNIKPVSQQ
YSGNNSTSVPKQPAPLVSNAVTGTVMNNTNYCVLNNGTSFGGGMMLMTNNQLHTGTTTTG
ISQRPMTNQMPIIPSSIPSNLVVLSFTPQNNSMNNQILGGPTAALQTSTITQQPAPQVPN
LSEQLKQCAKQPPPPPPNNDNVQKGLTLQPTAQNIHYTNPGPVFVSTAPNFSLPDLSRPP
PNMALKPPNSSLPGSGGGTVVATPTGQLQMCAGGAGQPATPVFTINHRPPSITPTPIRPR
SDLPPRPMTTFNERPFTPGNVGNIPDFTRPPVNLQPRLPSPAKGQHQQQGPRPQQNQPAN
FRGPIQIRPAISNPAGPRLDASATRFQGYATLQPTQQTSNIRLGMFANQSGPRQQFNGPG
QQNWQM
NT seq 5601 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaagcttcatagtccggcaggagccgaagctgtcagttacacgtggccactg
tcgaattcggatggaaaagaaggagctaatgaaatcatcgaaaccataagatgggtgtcg
gaagatttcccggagctggagacggcattggataacaacatcctacaggactatgatgtg
aggagctttgagagcatgaaacaactgtgtgacaagtataacaggaccattgacagcatc
ctccagctgtggaaaggaacatcccgcccccagaaaatcaaggaacgtccatctactggc
ctgctgaagcacatcctccaacagtgctatgaccatgcagtaaaagatccggagaggctt
aaccagtatgagcccttctctcccgaggtgtatggagaaacatcatttgatctggtggac
cagatgattaaatccatcaacttctcagaaaccgactactttatagaccttggcagtgga
gtcggacaagttgtcctgcaggtggccgcagcaacatcctgtaaaatgtgctatggtatt
gaaaaagcagagtatccagctaagtatgctgaggatatggagaagcagttcaagcgatgg
atgaaatggtacggaaagaaattcagcaactaccaactggacaaaggtgacttcctgtgt
gacgaaatggtcgaaaaaataaacaatgccactgtgatatttgtcaacaactttgcattt
ggacctcaggtagaccatcaattaaaactacgctttgccaatatgaaagaaggtgccaaa
atcgtatcttccaaggctttctgtccactgaacttccgcatcactgacagaaatctcagt
gatattggtactatcatgcacgttgcggaactgtcaccgctaagtggtgccgtctcctgg
acggggaaagctttcacctactttgtgcacacaatagataggactctgttggagaaatac
ttcctacgaatgaaaaatccgaaattgaaagatgatgaagatgtgcgtagagatcgtcga
gggagaccaatccatctacgagagaaacatacatgttgttctggtcatggtgattccaag
cctcatgaagagctgaagaatggtgctttgaagaagaaaattcgagccctagaggttaac
aagaatgaaatgccagctctcaatgttatcaaggaccactcctaccaggccgcacgcaac
ctagactttgacagtgccagtaacgccagcactgcgacaagtatgagtggcacagccgag
gaaatagctcaagtaatgggtggccccacaacgcggcgacagtggtccgagtgcctcagt
aaaccagcaccagaagtggcctcccctgaacatcctcctaccttcagggaggagagtgac
gagaatgctgtagtagttgatatccctaagaagatgaccaggacccgagcagcaaagacg
gcgtcaaagcgactcaggaacggacagttaaggaaagaaccacacaccgctgttggtgaa
gtgagcagtacccctccagtgacagggagaaagaaatccaatctgggaagccgtgcaaga
gccaacaaaaacaaggaaaaggagaaagttctggggctggacagtctcaatctgctgcac
acgcacacactaatgtccacagctgcatcacctgagagcaatgataagtggaatgatcga
agcatggtctccatgacgaacgcattcttcaagccgagtactcaggcccagactgtgtcc
tcactggagacagaaccagcactccaacgtctgcttgatctgttcagacaccagtacaac
aagttcctggcctacatgcagacaccagactacaagtccaatctgttactccagatagat
caggaaagggaaaagcagtcctgtttaaaatcgagagtggcataccttgaaaagcagatt
tatggcctacagaaggatagtgttggacagctgaaggcaaggatgagtgaaataaacttt
gtttcccagcttggtatagataccgattgtcccgcagacttcctcaccaaggccaagtca
atagtgcaggaacacaaggaattggagggtcagatggggactttaaaaggccaggtggct
tctctggaggcagatcggcgcaaactggtggaagttcagcaacaagtcctgcttgagaag
actggtggaataaacggcaaaaggaatggattccacaaacctacagtccaagagaatgtt
ttaaaagagattaataattcctattcccaaaagaagaacctgattaccaaagtacaggag
ctggaggtaaatttaaacgacttacaacagcataaattggccaggctggacgatgatatt
aaaggggatgacagcccatctcaggattcgggcatcagcctaacaccaaccgttccacct
ccacagtcacccgatgaggcagctacaaccgacatgtcagggaaacctttagggttatat
tttcaatcaacaactgacaaatctcaggaccaaaccaacgtttcagccgacactaagcaa
ataaagattgttactggtgctattagcggcttcagacagacgtcgccatgtaacaacttg
ctcgatcacaaaccttcagctaaagactcaggtacactaggagttagtgctagttctcat
gaaaaccattccagtataaaatcatcaccatatatgtcttcatcattgtcatcatcttca
tccccaccaccaccacgtaaacccggtgacggatatactcctggagctctatctatacga
atccttctagaggctagtggggagcaggtgcgtcagcggaataggggcgagatagcttcc
agactggctggttacaagtcaggtgtggtcaaagacctgcatcaggactcaactgggaag
ttagagtatgaacgaatcaaaaaggaggcaaagcctgctcatttgatcgaccaggtagtt
cacatggccctgtcatcgcaaccaacagacagtaaccagggtaatgtgttagtgacacac
aacaagaaggtcaaactgtcaaatggggtcaagtcctctgctaaaggtgtagctctggag
tcgaaccgacccaccctcccagtcagtataccactggaccagcttcagaaggagcagtta
cgacagaaaattctcaatcggacaggaccaagcaagcatgaggcgggtgatgtcacaagt
caggtgtcaaagcagtcaagtaagtctgatcatgatgctgggttttactcccctatcagt
cggcccagtagtcgtggcagcaccacagagtcagccgacgagcctggatgtgatgtcact
gcatcacactcgtacagtcctgctacagcgtccaacagtccccgtgggcctgggtacagc
tcatctagacacagaacggactctaaagcaaagacacctgctcgtgtgccagtaaataat
cactttgtggagaatatgtcgactcagaccaagtcaaacaatttgctgcatggtagaggt
caaagggtgcatactgatcaacagaagtttaacttagcagaggctttacttcaaatgtcg
gaggttaggagtaacaaaccagtgtctccacggcaggcattacccagtgtaccaacgaag
tgtggggacagctccaaatcacccaaaatgcggtacactctagagagctaccaagctgca
gacagaaaacgactgaaaaggaagaaaacagaaattcttgaaaatgataataaaaaaatg
gccttgtcctctaatgctgtgagctataccccgagtcatggggtgttggacagcatgcta
ggtcacacctctgggatcagttcattctcgtctcctgattcaggaatgtccacaccacat
gtacagagtccattgttcccgacggcccgaccaaaactcaaaagtcactataatcttcaa
aacagcagtgccaaagattcaccaagcaagaactggcaagctcagatcagcagtggtttt
gacgccctggttgctctagcttcatcagaattggataaaaatcgtgaaattcgtaggaaa
agtttagaaggacaaagtcctagtccacgcaaatcacaagtgataccaacaaagcaacat
gtctctctaagggactcattgcgtggaagggacaatgataaaagacggggtcctaaaact
ccgcctggttctcctcctagaagtaaacggggcccaagaacacccccaggatctccacat
tcacagaaaaaaggggtcaagggtcggagaaataatagttacagttcaagtcgtagccga
agttgtagtctttccagaacctctagtcacacgcagagcagcaggagtagctcccgcagt
agttgttactccagcagtaggagcagaagtcgatctcggagctcgtcatccagtcggagt
tctgggagtgggcgccacaggaacactaaaattagtttgaagaaggctagtgaaacagtt
aacaaacctgtggtgactcaccctgtgatcaattccaacataaaaccagtgtcccagcaa
tactcaggaaacaatagtactagcgtgccaaaacagccggcgcccctggttagcaacgct
gtgacaggtacagtgatgaacaatactaattattgtgttttaaataatgggacctccttt
gggggaggtatgatgttgatgacaaacaaccagcttcacactggcaccaccaccactggt
atttcacagcgacccatgaccaatcagatgccaattattccttcatccatacccagtaat
ttggttgtgttgtcttttactccgcaaaacaacagtatgaacaatcagatcctagggggt
cctacagccgccctacagaccagtaccataacccagcagcctgctccccaggtcccaaat
ctctcggaacagttaaaacaatgtgcaaaacagcccccaccacccccaccaaacaatgac
aatgttcagaaaggattaaccctacagccgacagcacaaaatattcactacacaaaccct
gggccagtgttcgtttccacagctccaaacttcagtctgcctgatctaagcagaccacca
cccaacatggccctgaagccaccgaactcaagtcttccaggtagcgggggagggactgtc
gtggctactccaacaggccagctacagatgtgtgcgggcggggcagggcagcctgccacg
cctgtattcaccatcaaccaccggcccccttccatcacccccaccccaatcaggccacga
tctgatctacctccaaggccaatgaccacattcaatgaacggcctttcacaccaggcaat
gtaggcaatatacctgattttactcggcctccagttaacttacagccaagattgccctcg
cctgctaaaggccaacatcaacagcagggacccaggccacaacagaaccaacctgctaat
ttccgtgggcccatacaaatccgtccagccatatccaacccagcaggtcctaggctagat
gcctctgctacaaggttccagggctatgctacactacagcctacccagcaaaccagcaac
atcagactgggaatgtttgctaaccagagtggacccagacagcagttcaatggaccagga
caacaaaattggcaaatgtga

DBGET integrated database retrieval system