KEGG   Mizuhopecten yessoensis (Yesso scallop): 110443027Help
Entry
110443027         CDS       T05079                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MSSLKSHSKDSKLPALTPGKLRLYSMRFCPFAQRTRLVLVHKKIEFETVNVDLKAKPDWF
LERNPLGLVPVLEQDDKVLYESVITCDYLDDVYPDNKLNPSDPYQRARDRILLESYGKVV
TNYYGTFRSQGKDKEILENLWKSLTPFEKAIGERGTYFGGDKPTMLDYFVWPWFERMGVF
SAILPGVDPMPAKQFPKLTAWVEVMKSLPAVKETMFDIPTHVAFYKGYAAGKPDYDVGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctcaaatctcactcaaaagattccaagttgccagctttaacgcccggaaaa
ctaaggctgtacagtatgaggttctgtccttttgctcaacgaaccagattagtattagtc
cacaagaaaatagaatttgagacggtgaacgttgatctgaaggcgaaacctgattggttc
ctggagagaaatccgcttggattggttcctgttctagagcaggatgacaaggttctatac
gagtcagtaatcacgtgcgactatcttgatgacgtctaccctgacaacaaactaaacccc
tctgacccttaccaacgggcacgtgacaggattcttctggagagttacggcaaggtggtg
actaattactacggaacgttcaggagccaaggcaaggacaaagagattttggagaatcta
tggaaaagtttgacaccttttgagaaagcaatcggagaaaggggtacctacttcggaggc
gacaaaccaacaatgctggactactttgtgtggccatggtttgaacgaatgggcgtgttt
tcagccatattacctggcgttgatcccatgccggctaagcagttccccaaactcacagct
tgggtggaagtgatgaagtcgctgcctgctgtcaaggaaaccatgtttgatatccccaca
catgtcgcattttataaaggatacgccgcaggaaaacccgactacgatgtcggtctatga

DBGET integrated database retrieval system