KEGG   Myxococcus hansupus: A176_000253Help
Entry
A176_000253       CDS       T04077                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
mym  Myxococcus hansupus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
295160..296878
Genome map
AA seq 572 aa AA seqDB search
MNAALAATARSSPLGLTFVDAAEREVTMPWSEVYARAKRTAAGLGRLGVSEGDRVALLLP
TSPAFMDAFFGTLLAGAVPVPLYPPVRLGRLEEYHRSTSRMLQVTGAVMVLTDAKVRLLL
GPSVEKARPRLGCHTVEAVSRGEDTREVAVRPDALGLIQFSSGSTVDPKPVALTHEALLA
QVSALELAMPLGDGVPRVGVSWLPLYHDMGLIGCLLSAMYYPGHLVLIPPEVFLARPALW
LRALSRHQAYISPAPNFAYGLCLKRVKDEDLGGVDLSAWKHALNGAEPVSSDTLHRFAQR
FERWGFSARALRPVYGLSEASLAVTFPPEGRGPRVLGVDAGLLAREGRVEAGSRELVSVG
QPVAGFEVEVRGETGEVLLERQVGRVFARGPSLMSGYFADAQATHRVLTPEGWLDTGDLG
FLADGELYLTGRAKDVVIIRGANHAPQAFEDPLQGVDGVRTGCAVALGFTPEGGGDEALL
ILAERAGSEADAGVEERIRTVVVEATGVRPHTVRLLEPGTLPRTSSGKLRRAEALRRFLA
EELAPPKRVGPVGLAVEMAKSALAMVRAESDS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcggcgctcgcggcgaccgcgcgctcctcgccgctggggctcaccttcgtggac
gcggccgagcgtgaagtgacgatgccctggtcggaggtgtacgcccgcgcgaagcgcacc
gccgcggggctggggagattgggcgtgagcgaaggggaccgggtggccttgctgctgccc
acgtcgcccgccttcatggatgccttcttcggcacgctgctcgcgggcgcggtgccggtg
ccgctgtacccgccggtgcggctggggcggctggaggagtatcaccggtccacctcacgg
atgctccaggtcaccggcgcggtgatggtgctgacggacgccaaggtgcggctgctcctg
ggcccgagcgtggagaaggcgcgtccccggctgggctgtcacacggtggaagccgtctct
cggggcgaggacacgcgggaggtcgccgtgcggcccgatgccctggggctcattcagttt
tcgtctggctccacggtggacccgaagccggtggcgctcacgcacgaggcgctgctcgcg
caggtgtcggcgctggagctggccatgcccctgggggacggcgtgccgcgcgtgggcgtg
agctggctgccgctgtaccacgacatggggctcatcggctgtctgctgtcggccatgtac
tacccggggcacctggtgctgattccccccgaggtcttcctcgcgaggcccgcgctgtgg
ctgcgcgcgttgtcccggcaccaggcctacatctcgcccgcgcccaacttcgcctatggg
ctgtgcttgaagcgggtgaaggacgaggacctgggcggcgtggacctgtccgcctggaag
cacgcgctcaacggcgcggagcccgtgtcctcggacacgctgcaccgcttcgcccagcgc
ttcgagcggtggggcttctccgcgcgggcacttcgtccggtgtatggcctgtccgaggcg
tcgctcgccgtcaccttcccgccggagggccgaggtccccgcgtgctgggcgtggacgcg
ggcctgctcgcgcgcgaggggcgggtcgaggcgggctcgcgtgagctggtgagcgtgggc
cagcccgtggcgggcttcgaggtggaggtgcgcggcgagaccggcgaggtgctcctggag
cgtcaggtgggccgggtcttcgcgcgggggccttcgctgatgtctggctatttcgcggac
gcgcaggccacccaccgggtgctgacgccggagggctggttggacacgggagacctgggc
ttcctcgcggacggcgagctgtacctcaccggccgcgcgaaggacgtggtcatcatccgc
ggcgccaaccacgcgccacaggccttcgaggaccccctccaaggcgtggacggcgtgcgc
acgggttgcgcggtggcgttgggcttcaccccggaggggggcggggacgaggcgctgctc
atcctcgccgagcgcgcggggtcggaggcggacgccggcgtcgaggagcgcatccgcacc
gtggtggtggaggccacgggcgtgcgtccgcacacggtgcgtctgttggagccagggacg
ttgccgcggacctcgagcggcaagctgcgccgcgccgaggccctgcggcggttcctcgcg
gaagagctggcgccgcccaagcgcgtgggcccggtggggctcgccgtggagatggccaag
agcgcgctagcgatggtgcgcgcggagagtgattcgtga

DBGET integrated database retrieval system