KEGG   Myxococcus hansupus: A176_002326Help
Entry
A176_002326       CDS       T04077                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mym  Myxococcus hansupus
Pathway
mym00620  Pyruvate metabolism
mym00680  Methane metabolism
mym01100  Metabolic pathways
mym01120  Microbial metabolism in diverse environments
mym01200  Carbon metabolism
Module
mym_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mym00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A176_002326
  Energy metabolism
   00680 Methane metabolism
    A176_002326
Enzymes [BR:mym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A176_002326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKQ65414
UniProt: A0A0H4WRJ8
LinkDB All DBs
Position
2738251..2740764
Genome map
AA seq 837 aa AA seqDB search
MAGRRAVAAELAEVLQRLPLEQAEPVLRAFSVYFQLVNLAEQHHRIRRARTHADAASAKP
QRGSLESTLLLLKEAGVPAQRVREAMGNMQVILTLTAHPTQAVRRTLLEKLYRMAGLLEE
RDRCELTPRESATNLESLREEITLLWQTDELRRERPTVGDEVKNVLWYVEEVLAEELSLL
PELLDWAFERAYGEPLGPVETPVRVHSWVGGDMDGNPLVTPDVFADTLRAHRARGLRRLL
QDLERLGGRLSQSARHAKPSEELLRSVEKDAQELPEAERRYGPRTPGEPLRHKLRFMEER
LHRALHYVTRQRAGEPIPMPSGAYRTPEALLADLDVLARALEASKGTHAGLRDVRRVRQR
VLALGLSLAELEVRAPAEDAVSAAASFDGGPEPTEGGQRLLQVLARLKDAQSESGEPACR
TLILSMASTAEDVLAAFKCLKHAGLWDDARGCATVDVVPLFEQLGALDSGPDVLRTLFAN
PEYRRQVDARGGQEVMVGYSDSGKEVGLLAASAALYRAQVALTEVCREAGVPLRLFHGRG
ESVARGGGPAQEAILALPPGAVAGGYKATEQGEALDHKYARPELARRTLELILGGVLLHT
LDAQPRPEVEAERTFRKAFDTLAETGRKAYRSLVWEDPSFLEFFTTATPVEEIASLPIGS
RPSKRRAGGLESLRAIPWVFGWTQNRAILPGWFGVGSALEAFAKEEGGAALLKRMYREWP
FFRAVIDNVTMVLAKSDMAIAGRYAALAPASTRALWRRIQQEHRRTRRQVKRLTGESKLL
DNNPQLQRSISLRNPYVDPMSFLQVELLKRKREGQAEVDRPLLLTLNGIAAGMRNTG
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
gtggccggacggcgcgcggtggcggccgagctggcggaggtgctccagcgcctgccgctg
gaacaggccgagcccgtgctgcgtgccttctccgtctacttccagctcgtgaacctggcg
gagcagcaccaccgcatccgccgcgcccgcacccatgcggacgccgcgtcggcgaagccc
cagcgcggctcgttggagtccacgctgctgctgctcaaggaggccggcgttcccgcgcag
cgggtgcgcgaggccatgggcaacatgcaggtgattctgacgctcaccgcgcaccccacg
caggcggtgcgccgcacgctgctggagaagctctaccggatggcggggctgctggaggaa
cgggaccgctgcgagctgacgccgcgcgagtccgcgaccaatctggagtcgctgcgcgag
gaaatcacgctgctgtggcagacggacgagctgcgccgcgagcgccccaccgtgggcgac
gaggtgaagaacgtcctctggtacgtggaggaggtgctcgcggaggagctgtccctgctg
ccggagctgctggactgggccttcgagcgcgcctacggcgaaccgctggggccggtggag
acgcccgtgcgtgtccactcgtgggtgggcggggacatggacggcaacccgctggtgacg
cccgacgtgttcgcggacacgttgcgcgcgcaccgcgcccgtgggctgcggcggctgctc
caggacctggagcggctgggaggccggctgtcccagtcggcgcgccacgcgaagccgtcc
gaggagctgctgcgctcggtggagaaggacgcgcaggagctgcccgaggccgagcgccgc
tacggcccgcgcacgccgggcgagccgctgcgccacaagctgcgcttcatggaggagcgg
ctccaccgcgcgctccactacgtcacgcggcagcgcgccggagagcccatcccgatgccg
tccggggcctaccgcacgcccgaggcgttgctggcggacctggacgtgctggcgcgcgcg
ttggaggcgtcgaagggcacgcacgcggggcttcgcgatgtccggcgggtgcggcagcgg
gtgctcgcgctgggcctgtccctggcggagctggaggtgcgcgcgcccgccgaggacgcg
gtgagcgcggcggcctcgttcgacggtggcccggagcccaccgaaggcggacagcgcctg
ctgcaggtgctggcgcgcctgaaggacgcgcagtccgagtcgggtgagccggcctgccgc
acgctcatcctcagcatggccagcacggccgaggacgtgctcgcggccttcaagtgcctg
aagcacgcgggcctgtgggacgacgcgcgcggctgcgccaccgtggacgtggtgccactg
ttcgagcagctcggggcgctggactccgggccggacgtgctgcgcacgctcttcgcgaac
ccggagtaccggcgccaggtggacgcgcggggtggccaggaagtgatggtgggctacagc
gactccggcaaggaggtggggctcctcgcggcgagcgcggcgctctaccgcgcgcaggtg
gcgctcacggaggtgtgtcgcgaggccggcgtgccgctgcggctgttccacggccgcggc
gagtccgtggcgcgtggcggcggccccgcgcaggaggccatcctcgcgctgccgcccggc
gcggtggcgggtggctacaaggccacggagcagggcgaggcgttggaccacaagtacgca
cgcccggagctggcgcggcgcacgttggagctcatcctgggcggcgtgctgctgcacacg
ctggacgcgcagcctcggccggaggtggaggccgagcggaccttccgcaaggccttcgac
acgctggcggagacgggccggaaggcctatcgctcgctggtgtgggaggacccgtccttc
ctggagttcttcaccacggcgacgccggtggaggagattgcctcgctgcccatcggctcg
cgccccagcaagcgccgcgcgggcgggttggagtcgctgcgcgcgattccgtgggtgttc
ggatggacgcagaaccgcgccatcctgccgggctggttcggcgtgggctcggcgctggag
gcgttcgccaaggaggagggtggggcggcgctgctcaagcgcatgtaccgggagtggccc
ttcttccgcgccgtcatcgacaacgtcaccatggtgctggccaagtcggacatggccatc
gccgggcgttacgcggcgctggcgcccgcgagcacccgcgcgctgtggcggcgcatccag
caggagcaccgacgcacgcgcaggcaggtgaagcggctgacgggggagtcgaagctgctc
gacaacaacccgcagctccagcgcagcatctccctgcgcaacccctacgtggaccccatg
tccttcctccaggtggagctgctcaagcgcaagcgcgagggccaggcggaggtggaccgt
ccactgttgctcaccctgaacggcattgccgccggcatgcgcaacaccggctag

DBGET integrated database retrieval system