KEGG   Myxococcus hansupus: A176_002912Help
Entry
A176_002912       CDS       T04077                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
Organism
mym  Myxococcus hansupus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3594942..3600242
Genome map
AA seq 1766 aa AA seqDB search
MDVCRTRATAQPGDWIYTFLDDMGEHALTYAELDAGARAVAALLQRHLSPGERALLLYPP
GREYALGFLACLYAGVVAVPAYPPDPMRLGRTLPRLQALIADCGARVALTTTFIADMVEP
LTEGAPDLRALRWLATDAVPASEAEAWRAPELSGDTVAFLQYTSGSTGTPRGVVLRHRHL
LHNSWLIARGFDASPQPVGVLWLPPYHDMGLIGGLLQPLFRDIPTVLLPPMSFLQRPLGW
LEAVSRFGGTVCGGPNFAFDLCVRKSTPEQRAALDLSRWEVAFCGAEPVRADTLERFAEA
FAPAGFRREAFYPCYGLAEGTLIVSGGARAAVPVARRFSREGLLHGEAKPPERDSAETVL
VGCGQSLGDQDLRVVDPRTGRPCEPGRVGELWVRGPSVADGYWQRPEETERTFHGRLADS
GEGPYLRTGDLGVLDGGEVFITGRLKDLLVLRGRNFYPQDLEHSAERSHPGARPGCGAAF
SVDVEGEERLVLVQEVSSKVASEADAGEVAAHIRAALGEAHGVAPHAVVLISAGSLPKTS
SGKVQRRASREAFLTGALDVVLAWREAGVDAQRAGPPLASPADAPVTAAASDDVLAVLAA
RVAPLLGVAVQALDVEAPLTHAGLDSLRALEVLHAVEEGWGVSPPVAYLLQGPSLRDVAR
WVEQARAEGAEAGLEPSADTHDGDADVMSDGQRALWFLQRLAPGSTAYLVSHAVRFTTPV
DAGALGRAFAQLVARHPALSSAFPEHEGAPVLRRADAPPILERTEAAGWTDDVLSERLHE
EAHRPFDLERGPLMRVRLYTGARGGDVLLLAMHHLITDFWSLEVLAGELGALYSAEVQGA
LARVPSPPPSAAGILQALARRRSGARTEVLQRWWRERLGGELPVLELPTSGPRPRLQSFR
GASVSFRVSPQTSARLKDLARAHGATPFMVLLAGYLSFLRRYSGQEDLIVGTPTAGRPRA
DLSRQLGYFVNPVALRAHVPRALSFSGLVAQVRTTVLEALEHQELPFPRLVEQLQPRRDP
SRAPVFQTMFALQSGRPGSEPLGAFAVGAPGARARLGELSVESVPLRPSGAAFDLSLVMA
EVDGAFAARLEYCADLFDNAAAARMVHHLGALLDAAAAQPDLPLVDLPWLAEKERRALLA
RGRKRHDARGEVVAGMVQRVESWARATPDAPALAAGPKRWSYRELSAWVDRLAARLRRQG
VGPEVRVGTLLERGSPEQVVAFLAVLKAGGTVVPLDPTYPPGRVSWTLSDAGARVLLAHE
RYAQRLEPLDAVTVLRWEAFDGASDGVSEVSPPGGAEPLADSAAYICYTSGSTGRPKGVV
VTYRGAAQLCESFARGLPIGPGSRVFLFASPAFDMSVSDYVAAWSSGSALHVSPGAPPMG
DALYRLLVEQRITSVMLPPSVALLLPEGPLPDLKLFMVGAESCPASLVSRFAEGRAFINA
YGPTEVTVCATWARLAPDDAGPVAIGSALPHLDVYVLDEAHQPVPEGVAGELYVGGLSLA
RGYLDRPDLTAERFVPDPHGEVPGARLYRTGDVVRWRADGQLDYLGRADAQLKLRGFRIE
PGEVEVALRELLGMRQAHVTAWRPSTVAEPRLVAYVVPPPGDVLPPGEMRARLRERLPEQ
LVPTDFVVLESLPMLVSGKVDTRALPKPALTVSPEGKPRTQMETQVAVAWAEALGLPAVD
VHAHFFDDLGGSSLSVVRACSRLVEALGRDVPITHFFEHPTVHALARRLQAEARPDDSTD
VKHQSRAEARRQALQRRGGRNPRGHG
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtgtgccggacccgcgccacggcgcagcccggcgattggatctacacgttcctc
gacgacatgggcgagcacgcccttacgtacgcggagttggacgcgggcgcacgcgccgtg
gcggcgctgctccagcggcacctgtcgccgggtgaacgtgcgctgctgctgtatcccccg
gggcgtgaatatgccctgggcttcctggcgtgtctctacgccggcgtggtggcggtgccc
gcgtatccaccggacccgatgcgcctgggccgcacgttgccgaggctccaggcgctgatc
gccgattgcggcgcgcgggtggcgctgacgacgacgttcatcgcggacatggtggagccc
ctcaccgagggcgcgccggacctgcgcgccctgcgctggctggccacggacgcggtgccc
gcgagcgaagcggaggcgtggcgcgcgcccgagctgagcggggacacggtggccttcctc
cagtacacctccgggtcgacggggacgccgcgcggcgtggtgctgcggcaccgtcacctg
ctgcacaactcgtggctgatcgcgcggggcttcgacgcgagcccccagcccgtgggcgtc
ctctggctgccgccgtaccacgacatggggctgattggcggcctgctccagccgttgttc
cgcgacattcccacggtgttgctacctcccatgtccttcctccagcgccccctgggttgg
ctggaggcggtgtcgcgcttcggcgggacggtgtgcggcgggcccaacttcgcgttcgac
ctgtgcgtgcgcaagagcaccccggagcagcgggcggcgttggacttgagccggtgggag
gtcgcgttctgcggcgcggagccggtgcgcgcggacacgctggagcgcttcgcggaggcc
ttcgcgcccgccggcttccggcgcgaggccttctatccctgctacggactggcggaaggc
acgctgattgtctcgggcggcgcgcgcgcggcggtgccggtggcgcggcgcttctcgcgg
gaggggttgctgcacggcgaggcgaagccgcccgagcgggattcggcggagaccgtgctg
gtgggctgtgggcagtcgctgggagaccaggacctgcgggtggtggaccctcggacgggc
cgtccctgcgagccgggccgcgtgggtgagctctgggtgcggggcccgagcgtggcggac
ggctactggcagcggccggaggagacggagcgcacgttccacgggcggttggcggactcg
ggcgaggggccctatctgcgcaccggtgacctgggcgtcctcgacggcggtgaggtgttc
atcaccggccggctgaaggacttgctggtgctgcgcgggcgcaacttctatccgcaggac
ctggagcactcggcggagcgcagccaccccggcgcgcggcccggctgtggcgccgcgttc
tccgtggacgtggagggcgaggagcgcctggtgctggtgcaggaggtctcctccaaggtc
gcgtcggaggcggacgcgggcgaagtcgccgcccacatccgcgcggcgctgggcgaggcg
cacggcgtggcgccgcatgccgtggtgctcatctccgccggctcgctgccgaagacgtcg
agcggcaaggtgcagcggcgcgcctctcgtgaggccttcctgacgggggccctggacgtg
gtgctcgcgtggcgggaggcgggcgttgacgcgcagcgcgccgggccgcccctggcgtca
cccgccgacgcacctgtgaccgcggcggcgagcgatgacgtactcgcggtgctcgcggcc
cgggtggcaccgctgctgggcgtggccgttcaggcgctggacgtggaggcgccactgaca
cacgccgggcttgactccctgcgggcgttggaggtgctgcacgcggtggaggagggctgg
ggcgtctctccgcccgtcgcgtatctgctccagggcccgagcctgcgagacgtggcgcgc
tgggtggagcaggcccgtgccgagggcgccgaggccggcctcgagccttccgccgacacg
cacgacggtgacgcggacgtcatgtccgacgggcagcgggcgctgtggttcctccagcgc
ctggcaccgggcagcacggcgtacctggtgtcacacgcggtgcgcttcaccacgcccgtc
gacgccggggccctgggccgcgcgttcgcacaactcgtcgcccgccaccccgcgttgtcc
tccgcgtttccggaacatgagggcgcgccggtgcttcgtcgcgccgacgcgccccccatc
ttggagcggaccgaggccgcgggctggacggacgacgtgctgagcgagcggctccacgag
gaggcgcatcgtcccttcgacctggagcgcggcccgctgatgcgggtccggctctacacg
ggggcgcgggggggcgatgtcctgctgctcgccatgcaccatctcatcacggacttctgg
tcgttggaggtgctggccggggagctgggggcgctgtacagcgcggaggtccaaggtgct
ttggcgcgggtgccatctccgccgccttccgccgcgggcatcctccaggcgctcgcgcgg
cggcgttccggagcgaggacggaagtccttcaacgctggtggcgcgagcggctgggcggt
gagctgccggtgctggagctgcccacttccggaccacggccccggcttcagtcgttccgg
ggcgccagcgtttcgttccgcgtgtcgccgcagacctccgcgcgcttgaaggacctggcg
cgagcgcatggcgccacgccgttcatggtgctgctggcgggctacctgtcgttcctgcgc
cgctactcggggcaggaggacctgattgtcggcacgcccaccgccgggcgtccgcgcgcg
gacctgtcgcgccagctcggctacttcgtcaaccccgtggcactgcgcgcccacgtgcct
cgcgcgctgtccttctccgggctggtggcccaggtccggaccacggtgctggaagcgttg
gagcatcaggagctgccgttcccccggctcgtcgagcaactgcagccgcgcagggaccct
tcgcgcgcgccggtcttccagacgatgttcgccctgcagtccggccgcccaggaagcgaa
cccctgggcgcattcgccgtcggggcaccgggggcgcgggcgcggctgggcgagctgtcg
gtcgagtccgtccccttgcgtccgtccggcgcggccttcgacctctccctggtgatggcg
gaggtggacggcgccttcgcggcgcggctggagtactgcgccgacctcttcgacaacgcc
gccgccgcccgcatggtgcaccacctgggcgcgctgctggacgccgccgcggctcagccg
gacctgccgctggtggacctgccctggctcgcggagaaggagcgccgcgcgctgctcgcg
cgtggaaggaagcgtcacgacgcacggggagaagtggtcgccgggatggtccagcgggtg
gagtcctgggcccgtgcgacaccggatgcacccgcgctcgccgccgggccgaagcgctgg
tcctaccgtgagctgtcggcgtgggttgaccggctggccgcgcggctgcggcgccagggc
gtgggccccgaggtccgcgtcggcacgctgctggagcgggggagtcccgaacaggtggtg
gccttcctcgccgtcctgaaggcgggcggcaccgtggtgccgttggaccccacgtatcct
ccgggccgggtgtcgtggacgttgtcggacgcgggcgcgcgggtactcctggcgcacgaa
cggtacgcccagcggttggagccgctcgacgccgtgacggtgctgcgctgggaagcgttc
gacggtgcttcggacggcgtctcggaggtgtcaccgcccggaggggccgagcccctcgcc
gattccgcggcctacatttgctacacgtccggcagcacgggccgacccaagggcgtggtg
gtgacctaccggggggccgcgcaactgtgcgagtccttcgccaggggcctgcccatcggt
ccgggttcacgggtgttcttgttcgcctcgcccgcgttcgacatgtccgtgtcggactac
gtggcggcctggtcctcgggcagcgcgcttcacgtgtcgccgggagcgccgcccatgggc
gacgcgctgtaccggctgctggtggagcagcgcatcacctcggtgatgctgccgccctcc
gtggccctgcttcttccggaaggaccgttgccggacctgaagctcttcatggtcggcgcg
gagtcgtgtcccgcgagcctcgtgtcccgcttcgcggaaggccgcgcgttcatcaacgcg
tatggccccaccgaggtgaccgtgtgcgccacgtgggcacgtctcgcaccggacgacgcg
ggcccggtcgccattggcagcgccttgccgcatctggatgtctacgtgctcgacgaggcg
caccagcccgtccccgagggcgtggcgggcgagctctacgtgggtggactgtccctggcc
cgtggctacctggaccgcccggacctcaccgccgagcgcttcgttccggacccgcatggt
gaggtgcccggggcccggctctaccggacgggcgacgtcgtccgttggcgcgcggatggt
cagctcgactacctgggccgcgcggacgcgcaactgaagcttcgcggctttcgcatcgag
cccggcgaggtggaggtggcgctgcgcgagttgctgggcatgcggcaggcccacgtcacc
gcgtggcgcccatccaccgtcgcggagccacggctggtcgcgtacgtcgtgccgccgccg
ggagacgtcctcccgccaggcgagatgcgcgcgcggctgcgtgagcggctgccggagcag
cttgtgcccacggacttcgtggtcctggagtccttgcccatgttggtctccgggaaggtg
gacacgcgggcgctgccgaagcccgcgctcaccgtgtctccggaaggcaagcctcgcacg
cagatggagacccaggtcgcggttgcgtgggcggaggcgctggggctgcccgccgtggat
gtgcacgcgcacttcttcgacgacctgggcggcagctcgctgtccgtggtgcgtgcctgt
tcgcggctggtcgaggcgctgggccgcgacgtccccatcacgcacttcttcgaacatccc
accgtccacgcgctcgcccggcggctgcaagccgaggcgcggccggacgactccaccgat
gtgaagcaccagtcgcgcgcggaggcccgcaggcaggccctccagcggcgcggaggaagg
aacccccgaggccatggctga

DBGET integrated database retrieval system