KEGG   Myxococcus hansupus: A176_003309Help
Entry
A176_003309       CDS       T04077                                 

Definition
(GenBank) Non-ribosomal peptide synthetase
Organism
mym  Myxococcus hansupus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4200757..4217928)
Genome map
AA seq 5723 aa AA seqDB search
MRPPSAVTLMELLEARTQSLGDTRLYTFLEDGGDDESLSYAGLDLRARRIGAALQALAQA
GERAVLLYPPGLEYVAGFFGCLYGGLIAVPAYPPDPTRLDRTLPRLRAIIRDARATVVLT
TAFILEMGEGLFEGAPELAALRWVATDSLPEGTEEGWRRPSPTRDTLAFLQYTSGSTGDP
KGVLLSNGNLLHNLGLISHAFEVHSDSVGVIWLPPYHDMGLIGGILQPLYAGFPVALMSP
LAFLRRPRFWLESLSRFGGTVSGGPCFAFDLCVRKVPPSEREGLDLSRWELAFCGAEPIR
PEVMLRFSEAFAPVGFKGGALYPCYGLAEGTLIASGGQKGAGVLTRTWDSEALERNEALE
AVGGPGARPLVGCGQTLPDQSLLVVDPEMRLPCPPERVGEIWVSGPSVALGYWERPEESE
AAFGARLADSEEGPRFLRTGDLGLMRDGELFVVGRRKDLIILRGRNLHPQDLELTVERSH
AALRPGCGAAFSIDVGGEERLAVVYEVDARKPWTAEDVVGAVRRGLSEAHEVQLHTLVLI
EPGALPKTSSGKIQRRACRAELLAGTSRSVLNWRESDSSPSTQMEAVRVPGEDSTPVTVE
ALEAWLLSRVAARLRTSPDELARDVPITSLGLDSLGAVELANDIEALGSVFRMEALLHGP
TVAELARTLFSARGGASGPALVRGEAGVAAPLSLAQQRLWLFEQLERGSPAYHLPAAVRL
TGPLDAKALERAFAEILQRHEALRMSLREDDGTPGQVAAPVPTPVLRWVDLRDTLAADQE
ASALKLAHDEARAPFDLVLGPLLRGTVFQLGAQEHLLVVVMHHIASDGASFGILARELSA
LYGGQAALAPLAFQYADFARWRRAQEADGAWASSLDWWKAHLAGTPTALELPADRLRPPT
PSYRGGRVSLQLPELLTAKLEALGRSEGATLFMTLLAAFEVLLARHSGQTDFCVGTAVNG
RERTGLEGLMGCFLDLVVLRASVAGAPRFRELLAQTRRTVLDAFAHRDVPFEQVVETVQP
ARDRARAPLFQVLFVLQPEPGAGLSLPGLEARRVEVDPGATPYDLTLSLARGAEGVGGWL
EYATDLFDAATAERLVARLRVLLEAVAADPEQPISTLPLLPEAERQRMLVDWNDTRTEAP
DACIHALVAAQVARTPDAVAVVCGAASLTYRELDQRANAVAWRLREQGVGPECVVGLCAD
RSVDLVVGLLGILKAGGAYLPLDPSYPEARLSLMLEDSGASVVLVHRHLAGALPFGGRTV
VLLDTSEGRASAAEAPSTAVGPENLAYVLYTSGSTGRPKGVLIPHRNVANFFTGMDGRVG
ATPGTWLSVTSVSFDISVLELLWTLARGFKVVVQGEQGALGAASRRPVRSRKKPLGFSLF
YFAADEGAAGAERYRLLLEGARFADRHGFEAVWTPERHLHAFGGLYPNPSVTGAAIAAIT
ERVAIRAGSVVLPLHHPVRVAEEWSLVDNLSKGRVGISVAPGWHANDFVLAPDNYADRRE
RSRQDLDTVRRLWRGETLRFPNGAGSPVDVRLRPSPVQKELPVWLTAAGNPDTFREAGRL
GAGVLTHLLGQRWEELEERIALYREAWREAGHAGEGHVTLMLHTFVGHDVERVREVVEGP
LRRYLSDSADLMRGLGRTLGVDLDPSSVRPEDLDALVERAFGRFFEGAGLFGTPRTCREQ
VARIEALGVDEVACLVDFGVDADAVLASLPALDAVRQRCERDFHLQSDGGDSVPAQLRKQ
AVTHLQCTPSLAQALLLEPGAQGALSGLERLLVGGEALPAELAARLRDTVGGALLNMYGP
TETTIWSSTHTVDGVSGAVPIGTPIANTSLYVLDDVLRPVPIGVPGELYIGGAGVARGYH
ARPELTAERFLPEPWGSQAGARMYRTGDRVRWRADGTVEFLGRADDQVKVRGFRVEPGEV
ESALVRHPDVSQAVVVAREDVPGSARLVAYVVSRSPAGVPVEALRDFARRSLPEHLVPSA
VVTLEALPLTPNGKVDRKALPAPEAAIDVARREYVAPRTETEQRVAELWATLLGMERVSA
NDDFFALGGHSLLATRAASRIREAFGVDLPLRELFESATPAALGARIDARLLGASRVPPL
VARTHSGALPLSFAQQRLWFLEQLEPGGAAYNDSVAVRVEGALDVAVLERCLREVVQRHD
VLRATFHDDSGTPSWRINAVEQLRLEQVDLSALAGEAQSTALATHLGKASLRAFDLASGP
PLRASLVRLSSREQVLLLVLHHLVTDGASMGVLVREVAVLYRAFAKGQPSPLAELPLQYV
DYSAWQRDWLRGDALDAQLTYWRQRLDGAPRVLELPTDHPRPAVRSSRGTNRSMLLGSEL
SLALKSLALREGATPFMVLLAGFSALLSRHSGQSDLCVGTPVAGRDRTELEGLIGCFVNT
LVLRVSLEGTPSFRELIGRARETVLGAFAHQDAPFEELVKALQPERDLSRSPLFQAMLVM
QEDPLPEMSVPGVRLSVQPQPSHTAKFDLRLIFTDTPEGYSANLELSSDLFDADTASRLL
AHLRELLTAGVREPEQAIVDLPLMPPEERHRVLVTWNDTLKSRAEPQVLHRLIEAQVDRT
PDAVAVSFEGETLSYRELDGRANQLARYLRARGVGPDVRVAMCAERSLEMVVGLLGILKA
GGAYVPLDPEYPRERLEYMLTDASAPVLLTQARLADGMPRGGATVVCLDSEWEGVAREHT
ERLDVRVQPQGLAYVIYTSGSTGRPKGAMNTHAAVCNRLLWMQEAYGLDASDRVLQKTPF
SFDVSVWEFFWPLMTGARLVMARPGGHREPAYLTDTVSRERITTLHFVPSMLRPFLEELD
LVSSCAGLRRVFCSGEALPADLRDRFFTVPRAELHNLYGPTEAAVDVTAWACAREDRRPL
VPIGRPIANARMYVLDERLRPVPPGVPGELFISGEPLARGYWQRPSLTAERFLPDTVAAV
PGARMYRTGDKARFLADGALEYLGRLDDQVKVRGFRIELGEIEAVLSQHAGVRAAAVAVR
EDIPGDRRLVAYVVATSEGEVSELRDFLGTRLPEHMLPSAFVTLEALPLSPSGKLDRRAL
PAPERSTLGAGDSYVAPRNALEQQLARIWADVLGVERVGTEARFFELGGDSILALQVIAR
ARQAGIHLTARQVFQHPTVAGLAQVAASARRLGEQGPVMGPVPLTPIQTWFVERDLPEAH
HFNQALLLEPREPLNAEMLSAALRALVDHHDALRLRLTRSTAGWEQSCAEPGRDVPLRQV
DLAGLTPAAQASEMERLATEAQAGLDLADGRLVRAVLFDRGAGQTGRLLLVIHHLAVDGV
SWRILLEDLETALGQLGRGGAVALPAKSTSFQAWARRLEEYAASPALTEELAFWRKAPDS
DVARLPVDFPAGVNSQGSERVVTSVLDADVTRALLRSAAAGRHTSLEDVLLAGVSRSLAR
WSGARRLRIDLESHGRDELFDDVDLSRTVGWFTALFPVRLDLSKGADAAAVLAEVHAARE
RRQGRGIGFGLLRYLRRDSTVAPASEVLFNYLGQVDAGSRASALFSLASESTGAAQGTRG
PRSHVLEVVARVVQGRLELSWRFSDALHSRETIDALARGCVETLTELARPTEERYPLSSL
QHGLLFQVLLEPGTDAYFEQRSWTLSGPVDVRALRGAWDAVVERHPALRTSFLWEGLDTP
LQVVGSRITLPWSEHDWRGLPSEDAQAQALETFLREDRVRGFELSRAPLMRVALLRLKDD
AWRFVWSFHHLLLDGWSLARVLGEVLEAYSVLVRGGEWRPGPVTDFRAYVEWLGHQQPER
DAAFWRELLEGVEAPTLLPAEGGVKGARDTGEQALELGDADTAVLQELARRHGVTPSTWV
HGAWAMVLSRYGGGADAVFGTTLAGRPPELPGIEEAVGLFIHTLPVRTRVRSTVALLAWL
RELQGLLVDLGQREHVPLTRLQEWSDIPRGVPLFESLLVFENYPVDAALGRGAAGLELKD
FGAFERTHYPLTAVAVPGRSLRLKVLYRRERIGDDAAATLVAHWRGLLRTMMARPEQRLG
DVPVLSEAERRRVLLEWNATETAYPREATVHGLFKAQAARTPSAIAVDHGGTTLTYAELD
ARAEQVASRLLRLGVQRGSTVGLCVERSAELVVGMLGILKAGAAYVPLDPAYPRERLAWM
LSDSGARVLVTQERLRATLPSDGVRVLSLDQVSVGEGDGAHVPLTPVSGAEDAAYVIYTS
GSTGTPKGVCVPHRAVVRLVVETDFIRVVPEDRVAQASNASFDAATFEVWGALLNGARLV
GVDRDTALSPRAFANWLKDAGIRVLFLTTAWFNQVVGEAPEAFGGLRQLHFGGEAVDPRP
VRRVLREGPPERLLHVYGPTENTTFSTWHLITDVPEDAAGIPIGRPLANTVQYVLDDAMA
PVPPGGVGELWLGGDGLAWGYLGRPDLTAERFTPNPFSPRPGARLYRTGDRVRLLPDGAV
TFVGRVDTQVKVRGFRVEPGEVEAALLRHPGVGQAVVLAREDAVGGSRRLVAYAVPSGVA
NAPLAASALRGFLVEHLPAYMVPSAITVLERLPLTPNGKVDRRALPEPTLEVETLAPRGP
EEALLAGLFGELLGVPRVGADDSFFDLGGHSLLATRVVTRIHATFGVALPLRDLFEEPTV
ARLAERIRQARVSSTWVRPPPIVPVSRERPLPLSAMQERLWLLEQLQPGTALYTVPWAAW
LSGPLDVPVLERALAALARRHEALRTTFSSNAGAPVQVIHPNLALPLSVVDLRGVPEGEA
QALRAAADEVRRPFDLVQGPLFRALLIRTAEDAHLLVLTLHHIISDGWSLGVAVRELTAL
YGAELHGRASPLPEPFLQPADHAVWQREWLQGEALTDQVGYWRKQLAGAPPVLELPKDFA
RPSLQRFRGDTVAVAIPSELSQSFRALCVREGVTPFMGLLAAFQLLLSRVSGQEDVCVGS
PIAGRQQPGLENLIGFFVNTLVLRSRLPRSLTFRELLHQVRETTLDAYARQDVPFEKLVE
ALQPPRSLSHAPLIQVVLALHEGTRRDAAPEGLTLRPVELASGTAKFDLTLSLADTAEGF
SGTLEFDADLFTRETATRWMHGLQVLMRSAVADAGQALGALPMMDAAERQQLLVTWNDTA
ANYPREACLAELFEAQAARSPDAIALECEDARLTYAELDRRANQLAWYLRKRGVAPGMPV
GLCLHRSIDLVVGMLGILKAGGAYVPLDPAYPKERLAFMVEDTRLSVVLAQQTVLALLPT
GSAEVVLLDSAWDDVSREPESAPKVSVPAESLSYVMYTSGSTGQPKGVCVPQRAVARLVL
GSRFARWGADEVFLQLAPICFDASTFELWGALLHGAKLVLFPPRTPTVDALKDVLTRHGV
TTLWLTAALFEALSAARPDALDGVRQLLVGGDVLPPASVRERLARGGVLVNGYGPTEGTT
FTCCHVMEGTIAEGAIPIGRPIANTRVYVVDAGLRPVPVGVPGELLIAGDGLAWGYLGRA
ELTAERFIPDPFGPETGARLYRTGDRVRYREDGTLEFLERLDAQVKVRGYRVEPGEVEEA
LRKHQSVAEAVVVARPDPAGGKRLVAYAVPRAGTTLEPRELRAFLAGSLPEFMVPSALVP
LTALPLTPVGKVDRSALPEPEVARLAGSTFTEPTSALERQVAVLWAKVLGVERVGVEDHF
FADLGGSSMSVVKACALLRDELKRDVPATRFFEHPTVRAFVMSLERDGEAAAETQDNEAH
VDRAQQRRQAIRRQGRRGNHGND
NT seq 17172 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccaccttcggctgtgacactcatggagttgctcgaagcccggacgcagtccctt
ggcgacacgcgcctctacacgttcctggaggatggtggggacgatgagtcgctgagttac
gcgggcttggacctgcgcgctcggcgcatcggtgccgcgctccaggcgctggcccaagcg
ggcgagcgggccgtgctcctgtatccaccgggcctggaatacgtcgctgggttcttcggg
tgcctctacggcgggttgatcgccgtccccgcgtacccgccggatcccacgcggctcgac
cggacgttgcctcggctgcgcgccatcatccgagatgctcgcgcgaccgtcgtcctcacc
accgccttcatcctggagatgggggaggggctcttcgagggagcgcccgaactcgcggcg
ttgcgatgggtcgccaccgattcgttacccgagggcaccgaagagggctggcgtcggccg
tcgccgactcgcgacacgctggccttcctgcagtacacgtccggctccacgggcgaccca
aagggcgtgctgctcagcaacgggaacctgctgcacaacctggggctgatctcccacgcg
ttcgaggtgcactcggacagcgtgggcgtcatctggctgccgccctaccacgacatgggg
ctcatcggtggcatcctgcagccactgtatgcggggttccccgtagcgctgatgtcgccc
ctggcgtttctccggcgtcctcgcttctggctggagtcgctttcccgttttggaggcact
gtcagcggcggaccttgcttcgcgttcgacctctgcgttcggaaggtgccgccgtcggaa
cgagaaggcttggacctcagccgctgggagctggcgttctgcggcgccgaacccattcgc
ccagaggtcatgttgcggttctcggaagccttcgctcccgtgggcttcaagggcggagcc
ctgtatccctgctacgggctcgcggaaggcacgttgattgcgtccggaggtcagaagggc
gcgggcgtcctgacgcggacctgggactccgaggcgctggagcggaacgaggcgctggag
gccgtgggcggtcctggcgcgcgtccgttggtcgggtgcggccagacgctgccggaccag
tcgctgctcgtggtggacccggagatgcggctgccgtgcccgcctgagcgggttggggag
atctgggtctccgggccgagcgtggcgcttggctactgggaacggccggaggagagcgaa
gcggccttcggcgcgcgtcttgcggactcggaggaggggcctcggttcctgcgcaccggt
gatctcgggttgatgcgggacggtgagctctttgtcgtgggtcgccggaaggacctcatc
atcctgcgtggccgcaacctgcatccccaggacctggagctgaccgtcgagcgcagccac
gcagcgctgcggcctggctgtggcgcggcgttctccatcgacgtgggcggtgaggagcgg
ctcgcggtggtgtacgaagtggacgcgcgcaagccgtggaccgctgaagacgtcgtgggg
gccgtccggcgaggcctgtccgaggctcacgaggtgcagctccacacgctcgttctcatc
gagcccggcgcgttgcccaagacctccagcgggaagattcagcggcgcgcctgccgagcg
gagttgctcgcggggacttctcgctccgtactgaactggcgtgagtcggactcgagcccg
agcacgcagatggaggctgtccgggttcctggagaggactccacgcccgtcaccgtcgag
gcgctggaagcgtggctgctgtcgcgggtcgccgcacgactgcgcacctcgcccgatgag
ctggctcgggacgtccccatcacgtctttggggctggactccctcggcgctgtcgaactg
gcgaatgacatcgaagcactgggttcggtgtttcgcatggaggccttgcttcacgggccg
accgtggccgagctggcgcggacgctcttctcggcgcgggggggcgcttcgggccctgcg
ctggttcggggtgaagcgggtgttgccgctccgctctcgctcgcgcagcagcggttgtgg
ctttttgaacagctcgaacgtggtagccccgcgtaccatcttcccgcggcggttcggctc
acggggcctttggatgccaaggccctggagcgtgccttcgcggagatccttcagcgacac
gaagcactgcggatgtcgctccgtgaggacgatggaacgccgggccaggtcgccgcgccc
gtgcccactccggtgctcaggtgggtggaccttcgcgatacgctggccgcggaccaagag
gcctccgcgctgaagttggcgcacgacgaggcccgtgctcccttcgacctggtgctcggg
ccgttgcttcggggcacggtgtttcaactcggggcgcaggagcacctgctggtcgtggtg
atgcatcacatcgcctcggatggcgcatcgtttggcatcctggcccgcgagttgagcgcg
ctctacggtggacaggccgcgctcgctccgttggcgttccagtatgccgacttcgcgcgt
tggcgtagggcacaggaggcggacggggcctgggcctcatcgctcgattggtggaaggcg
catctcgcgggaactccgaccgcgttggagttgccggcagaccggctgcgtccaccgacg
ccatcgtatcgcggcggtcgtgtgtcgttgcagctccccgagttactcacggcgaaactg
gaggcgctgggccggagtgagggcgccaccctgttcatgacgctgctagcggcgttcgag
gtgctgctcgcgcgtcattcgggacagactgacttctgcgtcggcaccgccgtcaacggt
cgagagcggacaggccttgaaggactgatggggtgcttcctcgacctcgtggtcctccgt
gcttccgttgctggagcgccgcgcttccgcgagctgctggcgcagacccggcggaccgtg
ctggatgcgttcgcccaccgtgatgttcccttcgaacaggtggtcgagaccgtccagcct
gcgcgggaccgcgcccgtgcgccgctgttccaggtgctgttcgtgctccagcctgaaccg
ggggcgggcctctcgctaccggggttggaggctcggcgcgtggaggtcgaccctggcgcc
acgccttacgatttgacgctgtcgctcgcccggggggcggagggtgtgggcggatggctc
gagtacgccacggacctgttcgacgcggccactgcggagcggctggtggcccggcttcgt
gtgctgctggaggccgtcgcggcggatccggagcagccgatctccacgctcccgctgctg
cccgaggcggagcgccagcggatgctggtcgattggaatgacacacggaccgaggccccg
gatgcgtgcattcacgctctcgtcgcggcgcaggtggcgcggactccggacgccgtcgcg
gtggtgtgtggcgccgcgtcgctcacgtatcgagagctggaccagcgcgccaacgccgtg
gcctggcgtctgcgggaacagggtgttgggcctgagtgcgtcgtgggcttgtgcgcggac
cgctcggtggacctggtggtggggctgcttggcatcctgaaggctggtggcgcctacctg
ccgctggacccttcctatcccgaagcgcgtctctctctgatgctggaggactccggggca
tcggtggtcctggtgcatcggcatctcgccggggctctgccgttcggtggccgaacggtg
gtgttgctcgacacttcggaggggcgtgcttcggcggccgaggcgccctcaacggccgtg
ggcccggagaatctggcgtacgtcctctacacctccggctccacgggccgaccgaagggc
gtgctgattccgcaccgcaacgtcgccaacttcttcacgggcatggacgggcgtgtgggg
gccactccgggcacgtggttgtcggtgaccagcgtctcgttcgacatctcggtcctcgag
ctgctctggacgctggcgcgtggcttcaaggtcgtcgtgcagggagagcagggggctttg
ggggcggcgtctcgccgtcctgtgcggtcgcgcaaaaagccgctgggcttcagcttgttc
tacttcgcggcggatgagggggccgcgggcgcggagcggtaccggttgttgctcgaaggc
gcgcggttcgcggaccgccatggcttcgaggccgtgtggacgcccgagcggcacctgcac
gccttcggcgggctgtacccgaacccctcggtgacgggcgcggccatcgccgccatcacc
gagcgcgtggccattcgcgcgggcagcgtcgtgctgccgctccatcatccggtccgtgtc
gccgaggaatggtcgctcgtcgacaacctgtcgaagggccgcgtgggcatctccgtggcg
ccgggttggcacgcgaatgacttcgtccttgctcccgacaactacgcggaccgtcgggag
cgctcgcggcaggacctggacaccgtgcggcggttgtggcggggggagacgctgcgcttc
ccgaatggcgcgggttcacctgtcgatgttcgccttcgtccgagccccgtgcagaaagag
ctgcccgtctggctcaccgctgccggcaatcccgacaccttccgcgaggcgggccggttg
ggcgcgggtgtcctcacgcacctgttggggcagcggtgggaagaattggaagagcgtatc
gcgctctaccgcgaggcctggcgtgaggctggtcatgcgggagaggggcacgtgacgttg
atgctccacacgttcgtggggcacgacgtggagcgcgtgcgggaggtggtcgaagggccg
ctgcgtcgctacttgagcgactccgcggacctgatgcgggggctgggccggacgttgggc
gtggacctggatccatcgtccgtgcgtcccgaggacctcgacgcgctggtggagcgcgcc
ttcgggcgcttcttcgagggtgcggggctcttcgggacaccgcgtacctgccgtgagcag
gtggcgcgcatcgaggcgttgggagtggatgaggtggcgtgcctcgtcgacttcggtgtg
gacgctgacgcggtacttgccagcctgcccgcgctggacgccgtgcggcagcgatgcgaa
cgcgactttcacctccagtcggatggcggggacagcgtgcccgcccagcttcgcaagcag
gcggtgactcacctgcaatgtacgccgtcccttgcccaggcgttgctgctggagcctggg
gcgcaaggtgcgctctcgggtctggagcggctgctcgtcggtggcgaggcgctgcccgcg
gagttggcggcgcggctgcgggacaccgtgggtggggcgctgctcaacatgtacggcccc
acggagaccaccatctggtcctcgacgcacaccgtggacggtgtctcgggcgctgttccg
attggtacgcccatcgccaatacgtcgctctatgtgttggacgatgtgctgcgtcccgtg
cccatcggcgtgcccggtgagctgtacatcggcggtgccggtgtcgctcgcggctaccac
gcgcggccggagctgaccgctgagcgcttcctgccagagccctggggttcgcaggcgggg
gcgcggatgtatcgcacgggcgaccgcgtccggtggcgggccgatggcacggtggagttc
cttggacgcgcggacgaccaggtcaaggtccgtggcttccgggtggagcccggcgaggtg
gagtccgcgctggtccgtcaccccgatgtctcgcaggccgtggtggtggcgcgggaggat
gtgcctgggagcgcgcggctggtggcgtacgtggtgtcccggtcaccggcaggggttccc
gtggaggcgctgcgggatttcgcccggcggtcgcttcccgagcatctggttccttcggcc
gtggtcacgctcgaggcgcttccgctgacgccgaatgggaaggtggaccgcaaggcgctt
cccgctcccgaggccgccatcgatgtggcccgtcgtgagtacgtggccccgcggacggag
accgagcaacgggtggcggagctatgggccacgctgttgggcatggagcgcgtcagcgcc
aacgatgacttcttcgcgttgggcggacactcgctgctcgccacccgggccgcttcgcgg
atccgcgaggccttcggcgtggacctgccgctgcgcgagctcttcgagtccgccacgccg
gccgcgctcggagcccgcatcgatgcgcgactccttggcgcgtcacgtgtgcccccattg
gtcgctcggacgcactcgggcgcgttgccgctgtccttcgcacagcagcgactgtggttc
ctggagcagctcgaacccggtggtgccgcctacaacgactcggtggccgttcgcgtggag
ggggctctcgatgtggcggtgctggagcgttgcctccgtgaggtggtccagcgtcacgac
gtcctccgcgccaccttccacgacgattcgggcacgccgtcctggcgcatcaacgccgtc
gaacagctccgtctggagcaggtggacctctccgcgttggcaggggaggcccagtccacg
gcactggcaacgcacctggggaaggcttcactgcgggcattcgacctggcctcggggcca
ccactgcgtgcctcgttggttcggttgagttcgcgggagcaggtgttgctgctcgtgttg
caccatctggtgacggatggcgcgtccatgggcgtgctcgttcgcgaggtggcggtgttg
taccgagccttcgccaagggccagccgtctccactggcggagctgccgcttcagtacgtg
gactactcggcgtggcagcgcgattggctgcgaggtgacgcactcgacgcgcagcttacc
tactggcggcaacggctcgatggcgcgccgcgcgtcctggagttgcccacggaccatcca
cgcccggccgtgcggagcagtcgcggcacgaaccggagcatgctcctgggctcggagctg
tccctggcgttgaagtccttggcgctgcgtgagggcgccacgcccttcatggtgctgttg
gcgggcttctccgccttgttgtcgcgtcactcgggacagagcgacctgtgcgtgggcacg
cccgtggcgggccgcgaccggacggagctggaaggactcatcggctgcttcgtcaacacg
ctggtgctccgcgtgtcgctcgaagggacgcccagcttccgtgagctgattggccgtgcg
cgggagaccgtgctgggcgccttcgcgcatcaggacgcaccgttcgaggagctggtgaag
gcgctccagcccgagcgtgacctcagccgcagtcccctgttccaggcgatgctggtgatg
caggaggaccccctgccggagatgtccgtccctggcgtccgactgagcgtccagccccag
ccgagccatacggcgaagttcgacctgcggctcatcttcacggacacccccgaggggtac
tccgcgaacctggagctgagcagcgacttgttcgacgcggacacggcatcccgcttgttg
gcgcacctgcgcgagctgctgaccgcgggtgtccgcgagccggagcaggccatcgtggac
ctgcccctgatgccacccgaggagcggcaccgtgtcctggtgacctggaacgacaccctg
aagtcgagggcggagccccaggtcctgcaccggctcatcgaggcgcaggtggaccgcacg
ccggacgccgtggccgtgagcttcgagggcgagacgctcagctaccgtgagttggacggg
cgcgcgaatcagctcgctcgatatctgcgtgcccggggcgtgggaccggatgtgcgggtc
gcgatgtgcgcggagcggtcgctggagatggtggtgggcttgctgggcatcctcaaggcc
ggcggcgcgtatgtgccgctcgacccggagtatccacgcgagcgcctggagtacatgctc
acggatgcctcggcgcccgtgctgctgacgcaggcgcggctcgcggacggcatgcctcgc
ggtggcgcgacggtggtgtgcctggattcggagtgggaaggggtggcgcgagagcacacc
gagcgtctcgatgtgcgggtccagccacaggggctcgcatacgtcatctacacctcgggc
tccacgggacggcccaagggcgcgatgaacacccacgccgccgtctgcaaccggctcctc
tggatgcaggaggcgtatggcctggacgcgagcgaccgcgttctccagaagacgccgttc
agcttcgacgtgtcggtatgggagttcttctggccgttgatgacgggggctcggctcgtg
atggcgcgtcccgggggccaccgcgagcccgcgtatctgacggacaccgtctcgcgcgag
cgcatcaccacgttgcacttcgtgccttccatgctccggcccttcctggaggagctggac
ctggtgtcgtcgtgcgcgggtttgcggagggtattctgcagtggcgaagcgctgcccgcg
gacttgagggatcggttcttcaccgtcccgcgtgcggagctgcacaacctctatggcccg
accgaggccgccgtggacgtgacggcatgggcgtgcgcgcgcgaggaccgcaggcccctg
gtgccgattggccggcccatcgccaacgcgcggatgtacgtgctggatgagagactgcgc
cccgttccgccgggcgtgccgggagagctgttcatcagtggcgaaccgctggcgcggggc
tattggcagcggccctcgctgacggctgagcgcttccttccggataccgtggccgccgtc
cccggtgcacggatgtatcgcacgggcgacaaggcgcgtttcctggcggatggggcgctc
gagtacctgggccgattggacgaccaggtgaaggtgcggggcttccgcatcgaactcggt
gagattgaagcggtgttgtcgcagcacgcgggtgttcgcgctgcggccgtcgcggtgcgt
gaggacatcccgggggaccggcgtctcgtggcctatgtggtggccacgtccgaaggcgag
gtctcggagctgcgggacttcctgggcacgcgcttgcccgagcacatgctgccttcggcc
ttcgtgacgctcgaggcactgccgctgtctcccagtggcaagctggaccgtcgcgcgttg
ccagctccggagcgttcgacgctcggcgctggagattcctacgtcgcgcctcggaacgcg
ctggagcaacagctcgcacgcatctgggcggatgtgttgggggtggagcgcgtcgggacg
gaggcgcggttcttcgaacttgggggtgactccatcctcgcgctccaggtgattgctcgc
gcacggcaagcgggcatccacctcacggcgcggcaggtcttccagcacccgacggtggcg
gggctggcgcaggtggcggcgagcgcgcggcggttgggcgaacaggggccggtgatgggg
cccgttccactgacacccattcaaacctggttcgttgagcgtgacctgcccgaagctcat
catttcaatcaggcattgctgctggagccacgcgagcccctgaacgcggagatgctctcg
gcggcactgagggcacttgtggaccaccacgatgcgctccggctgaggctgactcgcagt
accgcggggtgggagcaatcgtgtgccgaacctggccgcgatgttcccttgcgtcaggtg
gacctggcgggactgacgcccgctgcgcaagcctccgaaatggagcgcctcgccaccgaa
gcgcaagcggggctggatttggcggacgggcgcctcgtgcgcgccgtgctgttcgaccga
ggggcggggcagaccggccgactcctgctggtcatccaccatctcgcggtggacggcgtt
tcctggcgcattctgctggaggacctggagaccgcgttggggcagctcggccgtggtggg
gccgtggcgcttcccgcgaagtccacgtcattccaggcgtgggcgcggcgcttggaggag
tacgcggcctcgccggcgctcacggaggagctggccttctggcgtaaggcgccggactcg
gatgttgcccggcttcccgttgattttccggcgggcgtgaacagccagggttcggagcgc
gtcgtgacgtcggtgttggacgctgacgtaacgcgcgcactgcttcgttcggcggcggca
gggaggcacacgtccctggaggacgtgctgcttgccggtgtctctcggtctctggctcga
tggtccggagcgcggcggctgcgcatcgacctggagtctcacggccgcgacgaactcttc
gacgacgtggacctgtcgcgcaccgtgggctggttcaccgcgttgttcccggtgcggctg
gacctgtcgaagggcgcggacgcggcggcggtgctggccgaggttcatgcggcgcgcgag
cgtcggcagggcaggggaatcgggttcgggctgcttcgctacctgcgtcgtgattcgacc
gtggcccctgcgtccgaggtcctgttcaactacctgggacaggtggacgccggctcccga
gcgtcggcgttgttctcgctggcctcggagtccacgggcgccgcccaaggaacacgtgga
ccgcggagccatgtgctggaagtcgtggcccgagtcgtccaggggcgcttggagctgtcc
tggcgcttcagcgatgcgttgcattcacgtgagaccatcgacgcgctggctcgcggatgt
gtggagacgttgaccgagctggcgcgtcccaccgaggagcggtacccgctttcgtctctt
cagcatggcctgctgttccaggtgctgctggagcccggcacggatgcctacttcgagcag
cgaagctggacgctctccgggcccgtggatgtccgcgcgctgcgcggggcctgggatgcg
gtggtcgagcggcatcccgcgttgcggacctcgttcctgtgggagggactggacacgccg
ctccaagtcgtcggctcacgaatcacgctgccctggagcgaacacgactggcgtggcctt
ccctcggaagacgcgcaggcccaagccttggagacgttccttcgcgaggaccgggttcga
ggcttcgagctgtcccgcgcgccgttgatgcgggtggcactgctgcgtctcaaggacgat
gcgtggcgattcgtctggagcttccatcacctgctgctggatgggtggagcctggcgcgt
gtgctgggcgaagtgctggaggcgtactcggtgctggtccggggcggagaatggcgtccc
ggtcccgtgacggatttccgtgcctatgtcgagtggctggggcaccagcagccggagcgg
gatgcggccttctggcgggagctgctcgagggagtcgaggctccgaccctgttgccagct
gaggggggcgtcaagggggctcgagacacgggtgagcaggccctggagttgggggacgcg
gacacggccgtccttcaggaactcgcgcgtcgtcatggggtcacgccgagcacctgggtt
cacggtgcctgggcgatggtgttgtcacggtatggcggcggagcggacgctgtcttcggg
acgacgctcgcgggccgtccgccggagctgccggggatcgaagaggccgtgggcctgttc
atccatacgctccccgtgcggactcgcgttcggagcacagtagcgttgctggcctggctg
cgcgaactccaggggctgctggtggacctgggccagcgcgagcatgtgccgctcacccgg
ctccaggagtggagcgacatccctcgcggtgtgccgctcttcgagagcctgctcgtcttc
gagaactacccggtggacgccgcgctcggacgcggggccgcggggttggagttgaaggac
ttcggggccttcgagcgcacgcactatccgctgaccgcggtggcggtgccgggccgctcg
ttgcgcctgaaggtgctctaccgtcgagagcgcatcggggatgacgccgccgcgacgttg
gtcgcgcactggcgcgggctgctgcggacgatgatggcccggccggagcaacggctcgga
gacgtgcccgtgctgtccgaggcggagcgtcggcgtgtgctgctggagtggaacgccacg
gagacggcataccctcgcgaggccacggtccatggattgttcaaggcacaggccgcgagg
accccgagcgccatcgccgtggaccatggcgggacgacgctgacctacgcggagctggac
gcccgcgcggagcaggtggcttcacggttgctgcggctgggcgtccaacgcggttcgacg
gtgggcctctgcgtggagcgttcggcggagctcgtcgtgggaatgctcggcatcctcaag
gcgggggccgcctacgttccgctggatcccgcgtatcctcgtgagcggctcgcgtggatg
ctgtcggactctggcgcgcgggtgctggtgacgcaggagcgtttgcgcgcgacgctgccc
tcggatggcgtacgcgttctttccttggaccaggtctcggtcggggagggtgacggtgcc
catgtgccgctcaccccagtgtccggcgccgaggacgccgcgtacgtcatctacacctcg
ggctccacggggacaccaaagggtgtctgtgtcccgcaccgggccgtggtccggttggtg
gtggagacggacttcatccgcgtggttccggaggaccgcgtggctcaggcgtcgaatgcg
tcgttcgacgcggccacgttcgaggtctggggcgcgctgctgaacggcgcccggctggtg
ggcgtggatcgggacacggcgctgtcgccccgggcattcgcgaactggctgaaggacgcg
ggcatccgggtcctcttcctcacgacggcctggttcaaccaggtcgtgggtgaagcgcca
gaggccttcggaggcctgcgccagcttcacttcggtggcgaggcggtggacccacggccc
gtgcgccgggtgcttcgcgaagggcctcccgaacggttgctgcacgtctacggcccgacc
gagaacaccaccttctccacgtggcacctcatcacggatgttccagaggacgcggcgggc
attcccattggcaggcccttggcgaacacggtgcagtacgtgctcgacgacgccatggcg
ccggtgcctccggggggcgtaggggagctgtggctcggtggtgacgggttggcctggggg
tatctggggcggcccgacctgacggcggagcgcttcaccccgaacccgttcagcccacgc
cctggcgcacggctctacagaaccggggaccgggtgcggttgctgccggatggcgcggtg
acgttcgtcggccgggtggacacgcaagtgaaggtccgtggtttccgcgtggaaccgggc
gaagtcgaggccgcgctgctgcgccatcctggcgtggggcaggccgtggtgctcgcacgt
gaggacgcggtggggggctcccggcggctggtggcctatgccgtgccttcgggtgtcgcc
aacgcgcctctcgcggcctcggcgctgcgcgggttcctcgtggagcacctgcctgcgtac
atggtgccatccgccatcacggtcctggagcgcttgccgctcacgcccaacggcaaggtg
gaccgccgtgcgcttccggagcccacgctggaggtggagacgctcgctccacgcggaccc
gaggaggcgctgttggccggcctctttggcgagttgctgggcgtgccgcgcgtcggtgcc
gatgacagcttcttcgacctgggtggtcactcgctgttggcgactcgggtcgtcactcgg
attcacgcgaccttcggtgtggccctgccgcttcgagacctcttcgaggagccgaccgtc
gctcggctcgcggagcgaatccggcaggcccgcgtgtcatcgacctgggtgcgtccgccg
cccatcgttccggtgagtcgcgagcgcccgttgcccctgtccgcgatgcaggagcgactg
tggctgctggagcagcttcagccggggacggccctctacaccgtgccctgggccgcgtgg
ctgtcggggccgctggacgtaccagttctggagcgggcgctcgcggcgctggcgcgtcgt
cacgaagcgcttcgcacgacgttctccagcaacgcgggggcgccggtgcaggtcatccac
ccgaaccttgccctgccgctgtccgtggttgatttgcgcggagtcccggagggagaggcc
caggccctgcgcgccgcagctgacgaagtgcgccgtcccttcgacctggttcaggggccg
ttgttccgagccctgctgattcgcacggcggaggatgcgcacctcttggtcctcacgctg
caccacatcatctcggatgggtggtccctgggggtggcggtccgagagctcaccgcgctg
tacggcgcggagttgcacgggcgcgcgtcacccttgcccgagcccttcctccagcccgcg
gaccatgcggtgtggcagcgcgagtggctccagggcgaagcgctgaccgaccaggtgggt
tactggcggaagcagttggccggagcgccgccggtgctggagctgcccaaggacttcgcg
aggcccagcctgcagcgtttccgcggggacaccgtggcggtggccatcccctcggagttg
tcccagtccttccgcgcgctgtgtgttcgggaaggggtcacccccttcatggggctgttg
gcggccttccagctcctgctgtcgcgagtctcggggcaggaggacgtgtgcgtcggttcg
cccatcgcgggtcgacagcagccggggttggagaacctcatcggcttcttcgtcaacacc
ctggtgttgcgctcgcggctgcctcggtcgctcacgttccgggagctgctgcatcaggtg
cgggagaccacgctggacgcgtacgcacgccaggacgtcccgttcgagaagctggtggag
gccttgcaaccgccccgcagtctgagtcatgcgccgttgattcaggtggtgctcgcgctc
catgaaggcacgcggcgcgacgcggcgccggagggcttgacccttcgccccgtggagctg
gcttcgggcacggcgaagttcgacctcacgttgtcgctcgctgacacggcggaggggttc
tcggggacgttggagttcgacgcggacctcttcacgcgggaaaccgccacgcggtggatg
cacgggctccaggtcctcatgcggagcgcggtcgcggacgcggggcaggcgctgggggca
ttgccgatgatggacgcggcggagcgccagcagctcctggtgacgtggaacgacacggcc
gcgaactacccacgggaggcctgcctcgcggagctgtttgaggcacaagcggcgcgttcg
ccagacgccatcgcgctggagtgcgaggacgcccggctcacgtacgcggagctggaccgg
cgggcaaaccagctcgcgtggtacctgcgaaagcggggcgtggcgccagggatgcccgtg
ggcctgtgcctgcatcgctccattgacctggtcgtggggatgctcggcatcctcaaggcg
ggcggggcgtacgtgccgctcgaccccgcgtatccgaaggagcgactggccttcatggtg
gaggacacgcgcctgtccgtggtgctggcgcagcagacggtgttggcgttgttgcccacg
ggcagcgcggaggtggtgctcctggactcggcctgggacgatgtgtcccgtgagcctgag
tcggcccccaaggtctccgtaccggcggagtctctgtcgtacgtcatgtacacgtcgggc
tccacggggcagcccaagggcgtctgtgttccgcagcgcgcggtggcgcggctcgtgctg
ggttctcgcttcgcgcggtggggagcggacgaggtcttcctccaactggcgcccatctgc
ttcgacgcctccaccttcgagctgtggggggcgctgttgcacggggcgaagctggtcctg
ttcccgccccggacgcccaccgtggacgcgttgaaggacgtgctgacgcgccacggcgtc
accacgctgtggctcaccgccgcgctcttcgaggcgctctcggccgcgcggcccgatgcc
ctggacggcgtgcgccagctcctggtcggtggcgacgtgttgcccccggcctcggtgcgt
gagcggctcgcgcgcggcggcgtcctggtgaacggttacgggcccacggagggcaccacg
ttcacgtgctgccatgtgatggagggcaccatcgcggagggggccattcccattggacgc
cccatcgcgaacacccgcgtgtacgtggtggacgcggggttgcgtccggtccccgtgggc
gttcccggcgagctgctcattgccggcgatggccttgcgtggggctacctgggccgggcg
gagctgacggcggagcgcttcattccggatcccttcgggcccgagacgggcgcgcggctc
taccgcaccggagatcgcgtgcggtaccgcgaggacggaacgttggagttcctcgagcgg
ctcgacgcgcaggtgaaggtgcggggctaccgagtcgagccgggcgaggtcgaagaggcg
ctgcgcaagcatcagtcggtggcggaggcggtggtggtggcccggccagaccccgcgggt
ggaaagcggctggtggcgtacgccgtgcctcgggcggggacgacgctggagccccgcgag
ctgcgggcgttcctggccggttcgctgcccgagttcatggtgccgtccgcgctcgtgccg
ctcacggcgctgccgctcacgccggtggggaaggtggatcgctcggcgctgccggagccg
gaggtcgctcgtctggcggggagcacgttcacggagcccacctcggcgttggagcgccag
gtggcggtgctctgggcgaaggtgctcggcgtggagcgggtcggtgtggaggaccatttc
ttcgcggacctgggcggcagctccatgtccgtggtcaaggcgtgcgcactcttgcgcgat
gaactgaagcgcgacgttccggcgacgcgcttcttcgaacaccccacggtccgcgcgttc
gtcatgtccctggagcgggacggcgaggcggcggctgaaacccaggacaacgaggcccac
gtggatcgcgcccagcagcggcgacaggcgatccgtcggcagggccggcgagggaaccac
ggcaatgactga

DBGET integrated database retrieval system