KEGG   Mycobacterium abscessus DJO-44274: NF92_21730Help
Entry
NF92_21730        CDS       T03534                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mys  Mycobacterium abscessus DJO-44274
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4422614..4423678
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPE
LVAAVLAELPPRCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLL
ALGDEDYTGRPFSERRAALAEALSGAGASIHLTPATTDQALAQRWFEEFEGAGTDGLIAK
PLAIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGDNAIGSLLLGLYQEDGVLASVGVIG
AFPMAERKRLFQELQPLVIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctccaatcgcgccaatgcttgccaaacctgtcgcaaaaatc
cctgacggcgcctcctacgaacccaagtgggatggattcaggtcgatcgtctttcgcgac
ggcgacgaggtggagctgggtagccgcaacgagaagccactgacccggtacttccccgag
ttggtagcggcggtgctcgccgaactaccgccacggtgtgtcgtcgacggtgagatcgtg
atcgccaccgaagcgggtctggatttcgaggcgctgcaacaacggatccacccggctgat
tcgcgggtacggctattggccgagcagacaccctcctccttcatcgcattcgacctgctc
gccttgggcgacgaggactacaccgggcggcccttcagcgagcgccgtgccgcgctggcg
gaggcattgtccggcgcgggtgcgtcgattcacctcacgcccgccaccacagatcaggca
ctggcgcagcgctggttcgaggaattcgagggcgccggcaccgacggtctcatcgcgaag
ccgttggccatcgcctaccaacccgacaaacgagtgatgttcaagataaagccggagcga
accgcggattgcgtggtcgcgggctaccgagtgcacaaatcgggtgacaatgccatcggc
tcgctgctgctgggcctgtaccaggaggacggcgtattggcgtcggtcggtgtgatcggc
gcgttccctatggccgaacgcaagcgcctattccaagaactacaaccgttggtcatcccg
ctcgaaaatcacccatggaactgggccgcacacgaagccggcgagcgcactccgcagaag
aacgccggctcccgctggaacgcgggcaaggatctttcgttcgtcccgctgcgtcccgag
cgggtggtggaggttcgctacgaccacatggagggtgtgcggttccgccataccgcgcag
ttcaaccgctggcgcccggatcgcgacccgcgatcctgcacctacgagcagctagaacaa
ccaattacattcagcctcaacgatattgttccaggtctggtgtga

DBGET integrated database retrieval system