KEGG   Mycobacterium sp. VKM Ac-1817D: G155_07950Help
Entry
G155_07950        CDS       T03634                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:myv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    G155_07950
Enzymes [BR:myv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     G155_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIY45518
UniProt: A0A0A1FLC1
LinkDB All DBs
Position
1675949..1677421
Genome map
AA seq 490 aa AA seqDB search
MTTHTPARLQHLIAGQWISGEGDRVRSVDPSRPQSVVAEGGAASADHLGAAVAAAGDSVR
AWSATPMAERGGVLLAAAEILDGNAAEWGRDLSVEEGKTLAEGVGEVRRAAQILRYYGNE
GDRQAGEIYSSPRAGEQILVTRKPVGVVGVITPFNFPIAIPAWKIAPALIYGNAVVWKPA
STVPLLATHLARALDAAGLPAGVLNLLIGGSAIGDGIVNHPDVDAVTFTGSTGIGRRIAS
MAAARGVPAQAEMGGKNAAVVLDDADLDLAVEQVMLGAFRSTGQKCTATSRLILTENIAD
RFLDTLADRAGALVVGDPVDEATQMGPVVSEAAYKTITTGIDTARTQGATVLAGGQPYAD
ELRAHGYFIAPTVIELGDQPADLWTDELFGPVLAVRRAADAEEAFALANDSEFGLSAAVF
TQDLTRALQAVEHIDVGVLHVNSESAGADPHVPFGGAKKSGLGPKEQGSAAREFFTHTTT
VYLRGGAPRS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcatacaccggcacggcttcagcacctcattgccgggcaatggatttccggc
gagggtgatcgcgtccgcagtgtcgatccttcacggccacagtcggtcgtcgccgaaggc
ggcgccgcgagcgcagaccacctcggagcggcggtcgccgcggccggcgactcggttcgt
gcgtggtcggccaccccgatggccgagcgcggtggtgtgctgctggccgcggccgagatc
ctcgacggcaacgccgccgaatggggccgcgacctgtcggtcgaagaaggcaagacgctg
gccgaaggcgtcggtgaagtgcgtcgtgcggcgcagatcctgcgctactacggcaacgag
ggggaccggcaggccggcgagatctactcctccccgcgtgccggtgaacaaatcctggtc
acccgcaagcccgttggggtcgtcggggtcatcaccccgttcaactttccgattgccatc
ccggcgtggaagatcgcaccggccctgatctacggcaacgcggtggtgtggaagcccgcc
agcaccgtgcccctgctggcgacgcacctggcgcgtgcgctcgacgccgcgggcctgcca
gcgggtgtgctcaatttgctcatcggcggctcggccatcggcgacgggatcgtcaaccat
cccgacgtcgatgccgtcacgttcaccgggtcgaccggcatcgggcggcggatcgcgagc
atggcagccgcccgcggggttccggcgcaagccgagatgggcggcaagaacgccgccgtc
gtgctcgacgacgcggatctggacctggcggtcgagcaggtgatgctgggtgcgttccgt
tcgaccgggcaaaagtgcacggccacatcacgattgatcctcaccgagaatatcgctgac
cgtttcctggatacgctcgcagaccgcgccggggcactggtggtcggcgatccggttgac
gaggcaacgcaaatgggtccggtcgtcagcgaggcggcctacaagacgatcacaaccggc
atcgacaccgcgcggacccagggagccacagtgctggccggcgggcagccgtatgcggac
gagctgcgggctcacggctacttcattgcgccgacggtcatcgaactcggcgaccagcct
gccgacctgtggaccgacgagttgttcggcccagtgctcgcggtgcgccgcgccgccgac
gccgaggaagcgttcgcgctcgccaatgacagcgaattcggcctgtcggcagcggttttc
acccaggatctgacccgcgcactgcaagcggtcgagcacatcgacgtcggggtactgcac
gtcaactccgaatcagccggtgcggacccgcatgtgccgttcggtggcgccaagaagagc
gggctggggcccaaggaacagggctcggcagcccgggagttcttcacccacaccacaacg
gtgtacctgcgcggcggagcgccgcgctcatga

DBGET integrated database retrieval system