KEGG   Maylandia zebra (zebra mbuna): 101464348Help
Entry
101464348         CDS       T02814                                 

Definition
(RefSeq) alkaline phosphatase isoform X1
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00730  Thiamine metabolism
mze00790  Folate biosynthesis
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101464348
   00790 Folate biosynthesis
    101464348
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101464348
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101464348
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mze00537]
 Enzymes
  101464348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101464348
NCBI-ProteinID: XP_004562051
LinkDB All DBs
Position
LG15
AA seq 539 aa AA seqDB search
MLTPHYRVPSLLVILLGPILMPASRAAMDSQALYEIEKEPAYWDAQARATLDAALRLRPQ
EHQAKNIILFLGDGMGVSTVSAARILRGQMDGGSGEETILAMDTFPYVALSKTYSVDKQV
ADSASTATAYHCGVKANAKTVGLSAKAVAYECNTTFGNEVYSVLRRAKAQGKSVGIVTTT
RVQHASPAAAYAHSVSRSWYSDADLPSSAREHGCVDIATQLVTNVDIDVILGGGRMYMTP
KGTPDPEYPTSNSRKGDRKDKRNLIDVWLKAKPNKKSHYVWHRKEFDEINVKNTDRLMGL
FEPKDMRFEVFRNSTRDPSIVEMTEKAIQILKKNPKGYFLFVEGGRIDHGHHDGIAKLAL
TEAVMFDRAIHRAAQLTRESDTLTVVTADHSHVFTFGGNTARGNPIFGLAPKKADDQMPF
TSILYANGPGYVHINGTRENITLVDYYDEEYMQQAAVPLDAETHGGEDVAIYAKGPMAHL
FHGVKEQNYVAHVMAYATCLEPYTNCPPHTHRHTHSSSGSVNTPSSLLFFLLCVLLLFR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaccacattacagggtccccagtctcctggttatcctgctgggccccatcctg
atgcctgccagccgggccgctatggacagccaagccctgtatgagattgagaaagagccg
gcatattgggatgcacaagcaagggcgacactggatgctgcgctcagattacgtcctcag
gagcaccaggccaagaacatcatcctgttcctgggtgacggaatgggcgtgtccacagtg
tcagcagctcgaatcctgcgaggtcagatggatggtggatctggagaagagacgatacta
gccatggacacctttccatacgtggccctctctaagacctacagtgtggacaagcaggta
gcagacagtgccagcactgctacagcctaccactgcggtgtgaaggccaatgcaaagaca
gtaggactcagcgctaaagcggtggcctacgagtgtaacaccacctttggtaatgaggtc
tactcagttctgcggcgcgctaaagcacaaggtaaatcagtaggaatagtgaccaccacc
cgtgtccagcatgcttccccagcagccgcctacgcccactctgtcagccgcagctggtac
agtgatgcagatctgccttccagtgctcgcgaacatggttgcgtcgacattgccacccag
ctagtcaccaatgttgacattgatgtgattctcggtggaggcaggatgtacatgactcca
aaaggcaccccagacccagagtaccctacctccaactcccgcaagggggaccgcaaagac
aagaggaacctcattgatgtgtggctgaaggctaaaccaaacaagaaatcacactatgtt
tggcacaggaaggagtttgatgagataaatgttaaaaatactgaccgactcatgggtctg
tttgagcccaaagacatgagatttgaggttttccgaaatagcacgcgtgatccatccatt
gtggagatgacagaaaaggctattcaaatactgaagaaaaatccaaaaggatatttcctg
tttgtggaaggagggagaatcgatcacggtcaccacgatggcattgccaaactggcactg
acagaagctgtgatgtttgaccgtgccattcatcgtgctgcacagctcaccagagaatca
gacacactgactgtggtcactgctgaccactctcatgtcttcacctttggtggcaacacg
gctcgaggaaaccccatctttggattagccccaaagaaagctgacgaccaaatgcctttc
actagcatcctgtatgccaatggcccaggttacgtccatataaatggaactagagagaac
atcactttggtggattactatgatgaggagtacatgcagcaggctgctgtgccactggat
gctgagacacatggtggggaggatgtggccatctatgccaaaggaccaatggctcacctg
ttccatggtgtaaaggagcagaattatgtggcacatgtcatggcctacgctacctgtttg
gagccttacacaaactgtcctcctcacacgcaccgtcacactcattcctcctctggctct
gtgaacacaccttccagcctcttgtttttccttctctgtgttctcttgttgttcagatga

DBGET integrated database retrieval system