KEGG   Maylandia zebra (zebra mbuna): 101465538Help
Entry
101465538         CDS       T02814                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L-like
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101465538
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101465538
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101465538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2958 aa AA seqDB search
MDQKIQGRTATPPPLLSGAPTGEREKEGAGGKKEEEEEKKRDREKEGTPTASAGAGGTGG
PGGAGGDQSHFSIKESSLSEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHTGRG
GGNARGNRAGATGDGAGSQSQSPSQGREKEREKSPSVNRPPISSSSTAPTAKAPTPPPLA
PPPASTTTLTPSQMNGNAPAKKGPPKMDCKSDSKSDTKAATTTSERPLNLHRPPPDSKTH
SSGKKAPAPQPNPRTSSPSPPLSLTKEPSLEGVKPPQCTYSTDSQRDKDKGLQSWGAPTV
TEKLAQLIATCPPSKTPKPAKPAKIDPSPPLPSSGFMAPTAKQRDRALANRNTYSRMVHL
SPPPPVSRPPGRPYGSRSKDSILENSTTLTPLRNEDLDGTGKAASSNGNNSISMSSTNSS
SRSNSPAFTYGNNRLTVLSNESNSDSSNSSISKQPLHPAHSLPHTTSPSLCPISSSSSSS
VEQRTVSAVSHLGSPVPSQGHHARESPALAEESSAGEREQDRDIPRDLSKCPPSAATGRP
EGKEKGGSNQSVRVERGKSSSPSKRSPNQDSNRSGWTSSPTESIRQRTPSPLEPDDDDDD
DDEDDDEDDEEESPQTPLRDDSPDSSLDSPAEQDSKPLKKRRGRKPRWTRVMLKAQSQRS
PDSLFTENKTTMPLSSSLEIPTPPVKRPVGRPPNPNKVKPNPVSQNSVSQLFPPQPKKRG
RPKSKMPRLDAPARGNPPNKLQPSKVFSSLLKSKEEQDPPVLHPEVDLNPPKPMPRKRGR
PKRLPPTLPQEGQPPTLAPEAGERFRNKGNGQLIMKTIIGKINKMKSVKRKRILSQILLG
PRSEDTPKGTTSSMAATAEAATQSLSSLAASFGGKLGPQINVSKKGTIYMGKRRGRKPKV
ATNVSATMSPSETFISPNTTSPLHPHQSQSHQQHQLSSEVFSSPSLSQLSGGHSPISDGS
FVEPGSVHFAGHSHYSNSHHSHNTFSLPPPTFSAPNPRNPVMGSMSSSGVPVASQKKSSC
RGYHHHHHHYRQHYHYHKLSPPRPLHPTSPAPLSELKEATPSPVSESHSEETVPSDSGIG
TDNNSTSDRGEKAGGAGGLGAIGIPPGMGGGLLMPGVMGSAMGPGMGINSRGRRRHSNVL
MEHPSPSPSPHGTRSSPDPRRSHPAAPATTLVGHKEKHKHKCKRRSHGCPGYDKLKRQKR
KRKKKYLQLRSRRLDPDFLAELDEIVVRLSEIRITHRTTGHRLGSGIGIAAGSSRVPGVG
GRAAGAIGGTGGPPPHHYVHRDLLPTIFRVNFGSFYSHPPYSCDPLHYVRKPDMKKKRGR
PPKLRESMSEVPFVPGLGFPLSSGGFYHPSYVPYSSGPLGLGYYRGYPPASALYPHPHHQ
SPHTAPSHHTHHSPSFPPPPTSFLHHHHPSHLLLNHSKFHKKKHKLLRQEYLGAGRPPVL
YPPMSSELSFNWHHKHKHRHKHRERCAEDDREEAARGGSGSRASAGISDSGTSGKGERVS
GLGMAEALQRCRFGRDTSSTSASKQAATTSANSPSSSSSSSAERYKRKESSMSCLGPSRL
ALGNSSKGHSAESWFRIGNSEADYSKLSRSQLAPGQGSFSDGRAEDPAGCSDSEDEEPLT
PTEDVETHDSPKRTNLFASAITRTSLKGGRSRKTDVVTESSSFSHMDRPMRKEHSTSAER
REMGSSGIQTRGVTLPTSEEPEGSLHHRQQHHHQSSLFHSHSSTSSSCLSPSQECCLDVS
LSHNSHRVQPSKYSLLHVNKILRAKKLQRQARTGNNMVKKRGPGRPRKHPLPSPPPSPPP
VVELNQVRHREKGVERLAEGRGWEGDTVTDAIESVVQGQRRKGQKRKHWEREGDEEEEED
VEEDREAEDMEGHLPEREENLGSLVARSRPGTGRSWLTQDELQSLHGSVETKPDGHCSSE
GPGPVSREQAPPMPIATQREKRPARPPKKKFQKAGLYSDVYKTEDPRSQFLQLKKEKLEY
IPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWLWKHDQLHKRPDVPLYKKIRSNVYV
DVKPLSGYETTTCNCRLPEDSTEKGCMDECLNRMSFAECSPSTCPCGDHCDNQHIQRHEW
VQCLERFRTEGKGWGIRTKESLRSGQFIIEYLGEVVSEQEFRSRMMEQYFSHSGHYCLNL
DSGMVIDSYRMGNEARFINHSCEPNCQMQKWSVNGVYRIGLFALRDISSGTELTYDYNFR
SFNTEEQQVCKCGSEGCRGIIGGKSQRINGLPGKSGGTRRLGRLKEKRKSKHQLKKREEE
SSDSSKFYPHLMKPMSNRERNFVLKHRVFLLRNWEKMREKQELLKREGERERDASSLSMY
TRWGGVIRDDGNIKSDVFLTQFSALQTSRSVRTRRLAAAEENTEVTRTARLAHIFKEICD
MITSYKDSAGQTLAAPLVNLPSRKRNSQYYEKVSDPLDLSTIEKQILTGHYKTVEAFDTD
MLKVFRNAEKYYGKKSSIGRDVCRLRKAYYSARNEAAVQIDEIVGETASEADSSDSLDRD
HGHHHHTGGPGSHDKDDDVIRCICGMYKDEGLMIQCEKCMVWQHFDCMRLETEVEHYLCE
QCDPRPVDREVPMIPQPSYAQAGSVYYICLLRDDLLLHQGDCVYLMRDSRRSPEGQPVRQ
SYRLLSHINRDKLDIFRIEKLWKNEKGERFAFGHHYFRPHETHHSPSRRFYQNELFRMPL
YEIIPLEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRFPVCT
KPYAFNHFPKRLTPKRDFSPHYVPDNYKRNGGRSAWKSERPKEAGGCEDDASSCDRGEDF
PPEGEDGRGVEDDMDMASEDSALLSAKPRRPERERETGEEEDEEDGQEADERKGLEERSA
ERIGELLEVPSSSTSSPLHHPALGRREAQRERLNKILLDLLHRTPSKNAIDVTYLLEEGA
GRRLRRRALEFSDFVGRK
NT seq 8877 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaagattcaagggaggactgcaactccaccccctctcctgtccggtgctccc
acaggggagcgagagaaggagggagcgggtgggaagaaagaagaagaggaggaaaagaag
agggacagagagaaggagggaacccccaccgcatctgctggtgcaggaggcacaggcggg
ccaggaggtgccggtggtgaccagtcccatttctccatcaaagagagcagcctgtctgag
ggcaatgtcaaactgaagattggcctccaggcgaaacgcatgaagaagcctcctaagatc
ctggagaactatgtgtgccgaccggctttcagagccactgtgaggcatacgggtcgtgga
ggaggtaatgcccgtggaaaccgtgcaggcgccacaggtgacggggcgggcagtcagagc
cagagtccttcacagggcagagaaaaagagagggaaaagagtcccagtgtaaacagacca
cccatctcatcatcttcaacagccccaactgctaaagctcccacaccacctcctctagct
cctcctcctgccagcactaccaccctgacaccctcccaaatgaatgggaacgctccggca
aaaaagggtccaccaaagatggattgcaagtctgattcaaagtcagacacaaaagcagct
accaccacatctgagagaccacttaaccttcaccgccctccaccagacagcaaaacgcat
tcctctgggaagaaagcgccagctccgcaacccaacccccggacatcttcaccatctccg
ccattatctttaacgaaagaacccagccttgaaggtgttaagcctcctcaatgcacctac
agcacagacagtcaaagagataaggacaaaggtcttcagagttggggagcgccaaccgtc
actgaaaaattagctcaactaatagcaacttgtccaccatccaagacccctaagccagcc
aaacctgcaaagattgaccccagccctcctcttccgagctcaggctttatggcccctaca
gccaagcaacgagacagagctttggccaataggaacacatattcaagaatggttcacctt
tctcctccacctcctgtgtcaagaccacctggtcggccatatgggtctagaagcaaagac
agtattttagaaaattcaaccaccctgacgccgctgaggaacgaggacttggatgggact
gggaaagctgctagcagcaacggaaacaacagtatcagcatgagcagcaccaacagcagt
agtcgcagcaacagcccagcattcacctatggcaataaccgcctgacagtcctgtcaaat
gaaagcaacagtgacagcagcaacagtagcatttctaagcaaccgttacaccctgctcac
tccttaccccataccacgtcaccttcattgtgtccaatttcatcatcttcatcatcatcg
gtggagcagaggacggtgagtgcagtgagtcacctgggctcccctgttccctcacaagga
caccatgcacgagagtctcctgccctcgcagaagaaagcagtgcaggtgagcgagagcaa
gacagggacatccccagagacttatccaagtgccccccttcagcagcaactggaaggcca
gaagggaaagagaaagggggaagcaaccagtcagtacgagttgagaggggaaaaagttct
agtccaagtaaacgtagtcccaaccaggatagtaaccgaagcggttggactagcagtccc
actgagtctattagacaaaggacaccttccccactggaaccagatgatgatgatgatgat
gatgatgaagatgatgatgaagatgatgaagaagaaagcccacagacgcctctcagagat
gactctcctgattcatccctagactctccagcagagcaggacagcaaaccccttaaaaag
cgcaggggaagaaaaccccgctggacacgtgttatgctaaaggcccaaagtcagagaagc
ccggacagtctcttcactgagaacaaaaccaccatgcctttatcttcaagcctggaaatt
ccaacgccaccagttaaaagacctgtaggcaggcccccaaatccaaataaggtcaaacca
aatcctgtgtcacaaaattcagtgtcacagctcttcccaccccagcctaaaaaaagagga
aggccaaagtctaaaatgccaaggcttgatgcaccggcccgtgggaatccccctaacaag
ctacaaccctctaaggtcttttcatctttgttgaagtccaaagaagaacaggacccacct
gttcttcaccccgaggtagacttaaaccctcctaaacctatgcctaggaaacgtgggcgc
cccaagcgccttcctcctactttaccccaggagggtcagcctcccacgttggctccagaa
gcaggggaaagattccgcaacaaaggaaacgggcagcttatcatgaaaactattattggc
aaaatcaataagatgaaaagcgttaagcggaagcgtattctcagtcaaatccttttaggc
ccaaggtcagaagacacccctaaaggcaccactagtagcatggctgcaacagcagaagct
gcaacgcagtcgttgtcatccctagctgcttcttttggaggaaaactagggcctcaaatt
aatgtcagtaaaaagggcacaatatacatgggtaaaaggagaggccgtaaaccaaaagtg
gcaactaatgtctcagctacaatgtcaccttcagaaacctttatatctccaaacaccact
tcccctcttcatccccatcagtcacagtcccatcagcagcaccagctctcctcagaggtt
ttttcctcaccctccctctcacagttgagtggaggccacagtcccatcagcgatggtagc
tttgtggagccaggctcagtgcacttcgcaggtcactctcactattccaactcccatcat
agtcataacacgttttcgcttcctcctccaaccttttcagctcctaatcctcgtaaccca
gtcatgggctcgatgtcatcgtctggtgtcccagtagcctcccagaaaaagtcatcttgc
cgtggatatcatcaccaccatcaccattataggcagcactaccattatcataagctttcc
cctcccaggccactccatcccacctcccctgcccctctgagtgagctaaaagaagccacg
ccatcaccagtgagtgagtcacacagcgaggagactgtgcccagtgacagtggtataggg
acagacaataacagcacctctgaccgtggtgagaaagctggaggagcaggtggcttgggt
gcaattggcatcccacctgggatgggtggtggattattaatgccaggggtcatgggttca
gctatgggtccagggatgggcattaactcaaggggcaggcgtcgacacagcaatgtactt
atggaacatccttcaccgtctccatcaccccatgggacaaggtcatcgcctgatccccga
agatctcacccagcagctcccgccacaaccttagtgggacacaaggagaaacataagcac
aaatgcaaacgccgaagccatggctgccccggctatgacaagctaaagaggcagaagagg
aaacgcaagaagaagtacttacagctacgctcccgacggctcgacccagacttcctcgct
gagctggacgagattgttgtgcgactaagtgaaatacgcataactcaccgcaccacaggg
caccggctcggaagcggaataggcatagcagcgggatcaagtagagtgccaggggtgggt
ggcagggctgctggcgccataggaggcacaggtggccctccaccgcatcattatgttcac
agagacctcctgcctacaatcttcagggttaactttggcagcttctactctcatccacca
tactcctgtgacccgttgcactatgttcgtaaaccggatatgaagaagaaacgtggacgg
cctcccaaactgagggagtctatgtctgaggttccatttgtacctggacttggattcccc
ctttcaagtggaggcttctaccacccctcctatgttccttactcatcaggacctctgggg
ttgggctattacagaggttatcctccagcaagtgcgctgtatccccacccacaccaccag
tcaccccatacggccccatcacatcacactcaccactcaccgtctttcccacctcccccc
acatctttcttacatcatcaccacccatcacatctcctgctgaaccactcaaagtttcac
aagaaaaaacacaagctgctaaggcaggagtacctgggagcaggacggcctcctgtccta
tacccacccatgtcctctgagctctccttcaactggcaccacaaacataaacacaggcac
aaacacagagaacgctgtgctgaggatgacagggaggaagcagcaagaggtggatcaggg
agccgagctagtgcagggatttctgacagtggaacatctgggaaaggagagcgagttagt
ggtttgggaatggcagaggctttacagcgatgccgctttggacgagacacttccagcacc
agtgccagcaagcaagctgccactacctctgctaactccccctcttcttcctcatcctca
tctgctgaaaggtacaagcgcaaagagagctccatgtcctgtctcggaccttcaaggctt
gcattgggcaacagctcaaagggccactcagctgagtcctggttcagaataggcaactct
gaagcagactactcaaagctgtcacggagtcaattggctcctggccagggttccttctca
gacggacgggcagaagacccagcgggctgctcggacagtgaggatgaggagcctctcact
cccacagaggatgtagaaacccacgattctccaaagcgtacaaatctgtttgcttcagca
atcacccgcacttcactgaaaggaggcaggagcagaaagactgatgtagttacagagagc
tccagcttctctcacatggaccggccaatgaggaaggaacactcaacatcagcagagagg
agagagatggggtcatcaggtatccagacaaggggtgttacactcccaacctcggaagaa
cctgaaggatccctgcaccaccgccaacagcaccatcatcagtcttctctgtttcactcc
cacagctcaacctcctcatcctgcctctctccctctcaggagtgttgcctggatgtctca
ctgtctcacaactcccatcgcgtacagccctccaaatacagtctgctccatgtcaacaaa
atcctgcgtgccaagaagctgcagagacaggcccgtacaggaaacaacatggtaaagaag
agggggcctggacgtcctaggaaacacccgttaccctccccaccaccgtcccctccacct
gtggtagagttgaatcaagtccggcaccgggagaaaggggtggaacggttagcagaggga
agagggtgggagggtgatactgtgactgatgctattgagtcggtagtccaggggcaacgc
agaaaaggtcagaagcgaaagcactgggagagagaaggggatgaggaagaggaggaggat
gtggaagaggacagggaggctgaagacatggagggacacttgcctgaaagagaggaaaac
ctagggagccttgtggcaaggtccagacctgggacaggaaggagctggcttacccaagat
gagctacagagccttcatggctcagtggaaaccaagccagatggccactgctcatcagag
ggcccaggccctgtctccagggaacaagctccacctatgcccatagccacccagcgagag
aaaagaccagcacgacctccgaagaagaagttccagaaagcggggttatattctgatgtg
tacaaaactgaagacccccgtagtcagtttctgcagctgaagaaagagaagctagagtat
atacctggggaacatgagtatggattgtttcctgctccaatacatgttggaaagtacctg
agacagaaacgcattgacttccagttgccttacgacatcctatggttgtggaaacatgat
cagcttcacaagaggcctgatgtccccctttataaaaaaataagatcaaatgtttatgtg
gatgtgaagcctctctctggttatgaaacaactacatgcaactgtagacttcccgaagac
tcaactgaaaaaggctgcatggatgaatgcttgaataggatgagctttgctgagtgttct
cccagcacgtgtccatgtggagatcattgtgacaaccagcatatccagagacacgagtgg
gtccagtgtctggagcgtttccgcactgagggcaaagggtggggcatccgcaccaaggag
tctctccgctcaggacagttcatcattgagtatttgggtgaagttgttagcgaacaggag
ttcaggagtcgcatgatggaacagtacttctcccacagtggccactactgcctgaacctg
gatagtggcatggtgattgatagctacagaatgggcaatgaagcgcgtttcataaaccac
agctgtgaacccaactgtcagatgcagaagtggtcagtgaacggggtgtacagaataggt
ctctttgctctcagagacatcagcagcgggactgagctcacctacgactacaacttccgt
tccttcaatacagaagagcagcaagtttgcaaatgtggctcagagggctgcaggggcatc
atcggagggaagagccagcgtattaatgggttgcctgggaaatcaggagggactcggcgg
ctcggtcgactcaaggagaagaggaagtccaaacaccagctcaagaaacgagaggaagag
tcaagtgacagcagcaagttttaccctcatctgatgaagcccatgtccaacagagagaga
aactttgtgttgaagcatagagtttttctcttgaggaactgggagaagatgagggagaaa
caggagctgctgaaaagagagggcgagagagagagggatgccagcagcctgtccatgtat
acgcgctggggaggagtcatccgtgatgatggcaacatcaagtcagacgtgttcctgacg
cagttctcagccctgcagacgtcacggtcggtacgcacacgaaggctagctgcagccgag
gaaaacacagaagtaacacgcaccgctcgccttgctcacatcttcaaggagatttgtgac
atgataaccagctacaaggactccgctggtcagacacttgctgccccgctggtgaacctc
ccatctcgaaagaggaacagccagtactatgagaaggtgtctgacccgctggacctgagc
accattgagaagcaaatcctcacgggccattataagacggttgaagcatttgacacagac
atgctcaaagtatttcgcaatgctgagaaatattatgggaagaaatcatcaataggcaga
gatgtctgtcggctgcggaaagcctactacagtgctcgtaatgaagctgcagtccagatt
gatgagatagtgggcgagaccgccagcgaggcagacagctcagactcgctggaccgtgac
cacggtcatcaccaccacacaggagggcccgggtctcacgacaaggatgacgatgtcatc
cgttgcatctgtggaatgtacaaggatgaaggtctgatgattcaatgtgaaaagtgtatg
gtgtggcagcactttgactgtatgcgactggagactgaggtggagcactatctgtgtgaa
cagtgcgatccccggcctgtagatagggaagtccccatgataccccagcccagctacgcc
caggctggctctgtctactacatctgtctccttagagatgacctgctgctacaccaaggt
gactgtgtgtatctgatgagagacagcagacgctcacctgagggtcagcctgtcagacag
tcttaccgtctcttgtctcacatcaaccgagacaaactcgacatcttccgaattgagaag
ctgtggaagaacgaaaagggtgagcgatttgcctttggccaccactacttccgtcctcac
gagacacaccattctccatcgcggcgattctaccagaacgagttattccgcatgccgctc
tatgagatcatccccctggaggcagtggtgggaacctgctgtgttctcgacctttatact
tactgcaaaggacggccaaagggtgtgaaagagcaggatgtgtacatctgtgattaccgc
ttggacaagtcggcccatctgttctacaagatccatcgcaaccgttttccggtctgcacc
aagccatatgccttcaatcacttccccaagcggctcacgcccaaaagagacttctcgcct
cattatgttcctgacaactataagaggaacggcggccgatcagcctggaaaagcgaacga
cccaaagaagctggaggctgtgaggacgatgcctcttcctgcgaccggggtgaagatttc
ccacctgagggagaagatggaagaggagtggaagacgacatggacatggcttcagaagat
tccgcacttctttcagccaagcctagaagaccagaacgggaaagggagacaggagaagag
gaggacgaggaggatggacaggaagccgatgagcgcaaggggctggaggaacgctcagcc
gagaggattggagagttgcttgaagttccatcatcctcgacttcatcgccactacaccac
ccagctctgggcaggagggaggcccagcgggaacgactgaacaagatcctgctggatctg
ctgcacagaacacccagcaagaacgccattgatgtcacttatctccttgaggaaggcgca
gggcggcgcctgcggcggcgggcgctcgaattcagcgattttgtaggcagaaaataa

DBGET integrated database retrieval system