KEGG   Maylandia zebra (zebra mbuna): 101465626Help
Entry
101465626         CDS       T02814                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  
glucokinase [EC:2.7.1.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101465626 (gck)
   00052 Galactose metabolism
    101465626 (gck)
   00500 Starch and sucrose metabolism
    101465626 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    101465626 (gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101465626 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101465626 (gck)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101465626 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 478 aa AA seqDB search
MPCVSVQLDQMVKLPSSYDSVVDKVIAVDQILSEFRLNKEDLKEIMKRMQREMERGLRLE
THEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERSFKVETKNQMY
SISEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILLNWT
KGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVVDEASINPGQQL
YEKLISGKYMGELVRLVMMKLVNEDLLFNGEASELLKTRGSFETRYVSQVESDTGDRKQI
YNILSSLGVLPSELDCDIVRLVCESVSTRSAHMCATGLAGVINLMRERRSEEAMKITVGI
DGSVYKLHPCFRDRFHKVVRDLTPHSDITFIQSEEGSGRGAALISAVACKMATNLFAD
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgtcagcgttcaactcgaccagatggtgaagttgcctagtagctacgactct
gtggttgataaagtcatcgcggtggaccagatcctgtccgagttcaggctgaataaagaa
gacctgaaagagatcatgaagaggatgcagcgtgaaatggagagaggattgcgtttggag
acacatgaagaggctagcgttaaaatgcttccaacttatgtctgctccacccctgaagga
tcagaggttggtgatttcttggctctggacctgggaggcacaaacttccgtgtgatgctt
gtgaaagtgggtgaagacgaagagaggagcttcaaggttgaaacaaagaaccaaatgtac
tccatttctgaagatgccatgactgggactgctgaaatgctattcgactacatagcagag
tgtatgtcagatttcttggacaaacaccacatcaagcacaagaagcttcctctgggtttc
acgttctcctttccagtacgacatgaggacattgacaagggaatcctgcttaactggacc
aaaggcttcaaggcctccggtgcagaagggaacaatgttgtgggtttactcagagacgcc
atcaagagacgaggggactttgagatggatgtggttgccatggtgaatgacacagttgcc
acgatgatttcctgctattatgaagatcgcagctgtgaagtcgggatgattgttggtact
ggttgcaatgcatgttacatggaggaaatgaggactgtggagctggttgaaggggaggag
ggccggatgtgtgtgaacacagaatggggggctttcggagacaacggggagctagaggac
tttagactggagtacgacagagtggtggacgaagcctcaattaaccccggacagcagcta
tatgagaagcttatcagtgggaagtacatgggtgaactggtgaggcttgttatgatgaag
ctagtaaatgaagacctgctgtttaatggtgaagcctcagagctgctgaagacacgtgga
agctttgagacacgctatgtctcacaggtggagagtgacactggggatagaaaacaaatc
tacaacatcctgtcctcgctgggagttctgccctcagagcttgactgtgacattgtgcgt
ctggtctgcgagagtgtttccactcgctctgctcacatgtgcgccacagggctcgctggt
gtcatcaacctgatgcgggagagacgcagcgaggaagccatgaagatcacagtgggcatc
gatggatctgtctacaagttgcacccatgtttccgtgacaggttccacaaagtcgtcagg
gacctaacacctcactctgatatcaccttcatccagtcagaggaggggagcggtcgtgga
gctgctcttatctcagcagtggcctgtaaaatggctacaaatctgttcgcggattaa

DBGET integrated database retrieval system