KEGG   Maylandia zebra (zebra mbuna): 101465725Help
Entry
101465725         CDS       T02814                                 

Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101465725
Cell adhesion molecules and their ligands [BR:mze04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     101465725
   VLA-9
     101465725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 742 aa AA seqDB search
MSDEATIAAPSPAPPAPTGPPPKVTNRGRTAAPAASANSETSDIPEYEYFIQPGPRGYPP
LTEYLDISEVDMMKRPDESNKIAHHTALYHSDYLIVRRGQEFQVKITFSRPYKPAEDKFA
LEFVIGSSPQFSKGTYVPVFPTKQRQTTWEGRITNTSDNVVTMAITPAANCIVGKYQMYV
AVVTPYGIRRTRKESTRDMYILFNPWVAEDAVFLDDETERQECVMTEMGIIYHGSYDDIA
ERDWNYGQFNYGILDSCLYIMDRAEMPITNRGDPIKIVRVASAMLNSRDDEGVLVGNWSG
DYTYGVAPTSWTGSTDILLTYNSSKMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNYYSA
HDNDGNLKTDIIMDENGKIDRNRTRDSIWNYHCWNECYMSRPDLPPGFGGWQVVDATPQE
TSDGMYRCGPASVQAIKHGQICFPFDAAFVFAEINSDVVFHSRRKDGTLEPVRVNRTHVG
RLVLTKSPGDVTRRDITDQYKFAEGSTEERTVLEKAEEYGCKREKSSPPAADVDVVLPNL
EISVGDNFELNVEFENKSDERRTVDAYISGSVVYYTGVASTEFLFLTPRVVIEPKMNKKE
VAIVESKKYMKRLVEQANLHFIVTGKIRETGLIITAMKVVTLRNPKLIIEVSGRGKVSEE
MIATVEFTNPFSFNLENVYIRMEGPGMMEPKSRYYRLVIGGSSLTWTEYFTPQRAGTSRV
IATLDCPALRQVQGQASVTINP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgaagctaccatcgcggctccttctcctgctcctcccgctcccactggacct
cctcccaaagtgacaaaccgtggccgcaccgcagctcctgctgccagcgccaactctgag
acaagcgacatccccgagtatgagtactttattcaaccaggccccaggggataccctcct
ctgacagaatatctggacatcagtgaggtggacatgatgaaaaggcccgatgagagcaac
aagatagctcatcacaccgcgctgtaccactctgactatctaatcgtgcgcagaggacaa
gagttccaggtcaagatcaccttcagtcgtccctacaaacctgctgaagataagttcgct
ttggagtttgtcatcggctccagccctcagttcagcaagggcacctacgtccctgtcttc
cccacaaagcagcgtcagaccacttgggaaggccgcatcacaaacacctctgacaacgtg
gtcaccatggccatcaccccagcagcaaactgcattgtggggaagtaccagatgtacgtt
gccgtggtgacaccttatggcatccgcaggaccaggaaggaaagcaccagggacatgtac
atcctcttcaatccctgggtggcagaggatgctgtgttcctggatgatgagacggagagg
caggagtgtgtgatgaccgagatggggatcatctatcacggctcctatgatgacattgct
gagagggactggaactatggacagttcaactatggaatcctggattcctgtttgtacatc
atggaccgggctgaaatgcccatcaccaacagaggagaccccatcaagatcgtcagagta
gcctctgccatgctgaactctcgggatgatgaaggcgttttggtggggaactggagtggt
gactacacctatggagtggcacccacttcctggactggcagcacggacatcctgctcacc
tacaacagcagcaagatgcctgtctgctacgctcagtgctgggtgtacgctgctgttttc
aacaccttcttacgctgtctgggcatcccatctcgggtcgtcaccaactactactcagct
cacgacaacgatggaaacttgaagactgacataatcatggatgaaaacggcaagattgat
cgaaacagaaccagggactccatctggaactatcactgctggaacgagtgctacatgtcc
agacctgacctccctcctggctttgggggctggcaggttgtggatgcaacaccacaggag
accagtgatggcatgtacagatgtggacctgcgtcagtccaggccatcaagcacggacag
atttgcttcccatttgacgctgcgttcgtgtttgccgagattaacagtgatgtggtgttt
cattcccggaggaaagatgggaccctggagccagtcagagtgaaccgaactcacgtaggc
cgcctggttctgaccaaatctccaggagatgtgacccgccgcgacattacagatcaatac
aaatttgctgaaggcagcacagaggagcggacagtcctggaaaaagcagaggagtacggc
tgcaaacgagagaagtccagccctcccgcggctgatgtggacgtggtcctgcccaacctg
gagatcagcgtgggtgacaactttgagctgaacgtggagttcgaaaacaagagtgatgag
cgccgcactgtggacgcctacatcagcgggagtgtggtgtattatactggagttgccagc
accgaattcctgttcctgacccccagggtggtgattgaacccaaaatgaataagaaggag
gtggcaattgtggagtcgaagaaatatatgaagcgtctggtggaacaagctaacctccac
ttcattgttacggggaagatcagagagaccggtctaatcatcaccgcaatgaaagtcgtc
accctgcgcaaccccaaactcatcatcgaggtgtctggtagaggcaaagtgagtgaagag
atgatagcaactgtggagttcacaaaccccttcagcttcaacctggagaacgtctacatt
cgcatggaaggacctgggatgatggagccaaagtccaggtattacaggttggtcatagga
ggctcttctctgacctggactgagtatttcactccgcagagggccgggacaagcagggtg
atcgccactctggactgtcctgctctccggcaggtccaaggccaggcgtctgtcaccatc
aacccctga

DBGET integrated database retrieval system