KEGG   Maylandia zebra (zebra mbuna): 101471514Help
Entry
101471514         CDS       T02814                                 

Gene name
setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101471514 (setd2)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101471514 (setd2)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101471514 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 101471514
NCBI-ProteinID: XP_014267585
LinkDB All DBs
Position
Un
AA seq 2603 aa AA seqDB search
MGDPCDLKHFVKEEGSGASVKVEGLSKAALIKSLSPRVMLSNHLLPKGTKMKVNLEDQGR
QKVSFSFSQTKKPLQSSFFIPPSPDKSDPHAASSQSTSEKPGKSADSKTEQRQTPLVPVS
KTETPQTPVPTATKVKMMHFKKQILNDSVTEEKQSVMPEEPHTSLFQNELPAPQSLISTC
PSESAHTETSETRETSSLKKPAASSGKDGETSSSTEQDEKIHKRKTRSQSDSAPPGSESD
GDSAQMSSSHKSVDSKSKTNSDSRSKDVRKSSSGSHAEEREKSFSKRSENYERSSSYSKS
DRDSRHTSSRSSRSEKDRRRSRSRSRSRSRGSRTSSSHSRSDRIRSDRGSRSERSYYHES
DRRSHRSSPRRDRRRSRSRTDRTRDSSDSEDDHRKTRSRTSDNSRSSNHSSSHKESKSSS
YSKSEKTSKSVDSPHFSELDKRTQSSKSERITKRLSDSDTLRKGSPDLDSSHRKSSSHHK
SEANNKSSSSSSYTHSQTHEKRQKSSPSDSETDHKGKLQSSNRSSSSLENCKNSQKKSSR
PESKQVPSRSSVKSSGQDRQSDDLFHSPGKAPSCATTTESFSQSSKEKSDSQPVENENGN
KDEKEVGSCGEGLQELSLKTEAKSGLEMENNIASDVTYSESLKHVNSTLENVSNVKDSLS
SNDPTHVNSNASVVNLCSGNDSTMCNKDEEIFYCSTGPESVLHSVDKAVTEAVQQNTKPE
NVELDEAQPVSKESDTNLPVKSDSSCLQSENPPESLPTDVKKGSCSTRKSRWDIVGQDSS
ESENSQRTVCVESKLLNTVKKVISVKKIEFSKDNAQQDCDIKDDIQQEAGTHSRLVRQTE
ISKQEVQSESTPVTFNCKDQSEPSQASTSNDHCDSKLSASQKSNTDQPLHINDKIQINSA
ATAQHSNEENSENKSKDSASKSKLSKRMSPSQDASGQSEASDSDNSEYDSDCDEAIKQLH
SVVVVPKNSCLTMNTEERGPLNILQQQNALAAEKHISEPPNQVSQQKKQPTTQTGISDSL
SNSTLCQSQSNMIDSTSHSEASTSISTQPYTAGHTSSHASVTDSTPMRDNSKQCEQGHKQ
HDVSNRGDRTHVHYQQDHFSRADNINEKHEFNLGWDFSQPEQPTSTYQQPDSSHGPQLTN
TKLSGSFSKEQEHRPSTASCIQQSQNMQTSRKNYLHANVIDQDPSGEIQPDSLTNDHDDF
SGDKSSSCSKTAFEGSGPNTQGSSSFVQGHEISSNSRGSAVPDPSREDSFRPHRGRGPPK
KRRPEIESDSDNEAEAGPAAKRDRQGDTEVAKETLVKSAADRPSLTLQDFQDANRWKEFA
KSKKMPPYFDLIEENLYLTERKKSKSHRDIKRMQCECPVLPREDRARGVLACGDDCLNRL
LMIECSSRCLNGAYCSNRRFQMKQHADFDVILTEDKGWGLRAAKDLASNTFVLEYCGEVL
DHKEFKTRVKEYARNKNIHYYFMSLKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNG
QLRVGFFTTKAVTAGTELTFDYQFQRYGKEAQKCFCGAPSCRGFLGGENRVSVRAAGGKM
KKDRSRKSALTTVDEELEALLENGEGLYDEKQVVSLCRLMVRVETMEQKLICLKLIQDTQ
NPSCLKQFLDHHGLSLLWIFMVELSEAKGNSANNIKLQLQIMKTLSVLPISTKNMLEESR
VLTFIQRWAQTKTLPQQTEMDGYSSENTSRAQTPLNTPDGSSAKMGPELDSDTSKPAVYR
RLKIISENSLDSALSDASKASDGKEEEEEEDDEEDDENSRAGLPEGKQLKPDTPVDAADP
TTDSVEESGKEVIGEKQEEAAMTSSSEPQPPTEEVKEKPDLVVEEDSDIKEVKSEDQADE
LEPAKEPVETQESGKPQDNQSVTENAELEEGQPSVKVHEPETQSSQTGVADAPPEQPSET
MESQTEAEEAKKTLPSSEPHSGEPTTDVPPIAEAPEATIPSAVTATPVDPSVIGTPSQDE
EEGVSDVESERSQEPQLSVFDISGMAARLLESWKDLKEVYRIPKKTQVDKEGRDRSRDRD
TSFTPRTTSGSREREREKERERDRDRDWDRDRDRDWDRDRDRDWDRDRDRDRGSEKTPRS
SERRRRRSPSPPSSYERSSRRTEERFDPSNSSKTPRGVGGKERNKLSTEERRKLFEQEVA
QREAQKQQQLQQQQQLQSLAYDPALAYASSPGFITYPPGYPIQTFVDPSNPNAGKVLLPT
PTVEPSLNYEQTPPQRLVSDLGLTSPSSTPQTTPVTNLPQHVTTANLASGNPQHYAQPTV
ATQDAGVAVLSVPAQSAPQVQGQQSYTTLWDPTTQQAVTVQTQPAQQYATAPGQGQTPTA
IYYQGQPCQTIYSIPAPYPQTNTPVIQAYTDPTASYLHGQPVYPGQQGVVVQQGGTVTTI
VTSQTVQQEMIVPNSVIDLPPPSPPKPKTIVLPPNWKVARDPEGKIYYYHIVTRQTQWDP
PTWEGNSDNTSVDHESEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKETFRKEMSQF
IVQCLNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKACKNPEDLECNENVKHKTK
EYIKKYMQRFGAVYRPKEDTEVY
NT seq 7812 nt NT seq  +upstreamnt  +downstreamnt
atgggggatccctgtgaccttaaacacttcgtaaaagaggaagggagtggtgcatcggta
aaggtggagggcctgtctaaagcagctctaatcaaaagcctgtctcccagagtcatgctg
tccaaccaccttttgcctaaagggaccaagatgaaggtcaacttagaagatcagggtcgt
cagaaagtgtccttcagcttctcacagacaaagaagccactccaaagctcgttcttcatc
cctcccagtcctgataagtcagatcctcatgctgcctcgtcacagtcaacctccgaaaaa
cctggaaagagtgcagacagcaaaactgagcaaaggcagacacccttggtgccagtatca
aaaacagagacacctcagacgccagtccccacagctactaaagtgaaaatgatgcatttc
aagaagcaaattcttaatgactctgtgactgaagagaaacagtcagttatgccagaagag
ccgcacacctctctatttcagaatgaactcccagcaccccagagtctcatcagcacctgt
ccctctgaaagtgctcacactgaaacctctgagacgagagaaacctcaagcctcaagaaa
ccagctgcttcctcaggaaaagatggggagacatccagcagtactgagcaggatgaaaag
atacacaaaaggaaaaccaggtcacagtcagatagtgccccccctggctccgaatctgat
ggagattcagcccagatgtcttccagccacaaatcagttgattccaaaagtaaaacaaac
tctgacagcagaagtaaagatgtaagaaaatcttcttctggttcacatgcagaggaaagg
gaaaaaagtttctcaaagcgctcagagaattacgaaaggtcgtctagttactcgaaatca
gaccgtgattccagacacacatcttcacgctcatcccgatcagagaaagatcgccgaagg
tccagatctagatcacggtctagatcaagaggttctcgaacaagttcttcacactccaga
tcagacagaattagaagtgacagaggatcgcgctctgaaaggtcctactatcatgaatca
gaccggagatcgcacaggagttctccacgcagggatagaagacgttctcgctctcggact
gacagaactcgggacagttccgactctgaagatgaccacagaaaaacaaggtcgaggaca
agtgacaacagtaggtcatctaaccactcaagctcacataaggagtcaaaatcatcatcc
tactcaaaatctgaaaaaacctcaaaatctgtagattcacctcacttttcagagttggat
aaaagaacacagtcctcaaagtctgaaaggattacaaagcggttatcggactctgatacc
ctacgcaagggttctcctgatctggactccagtcaccgtaaatctagcagccatcataag
tcagaggccaacaataaatcttcatcttccagtagttacacacactctcagacacatgaa
aaacggcaaaaaagcagccccagtgactctgaaacggatcataagggcaaattacagtca
tccaacagaagctccagctccttggagaactgtaaaaactctcaaaagaaaagcagtaga
ccagagtcgaaacaggtcccctctagatcttctgtgaaatcttctgggcaagatagacaa
tcagatgatttatttcatagccctggaaaagcaccatcttgtgcaaccacaacagaatca
ttttctcagagttcaaaagaaaaatccgattcccaaccggttgaaaatgaaaatggcaat
aaagatgaaaaggaggtggggtcttgtggtgagggtttgcaagaactgtcacttaagaca
gaagcaaaatcaggtcttgaaatggaaaataacattgcctctgatgtcacttacagcgag
agcctaaagcatgtaaactctactctggaaaacgtgtctaatgtgaaggatagcctttcc
tctaatgatccaacacatgtgaactcaaatgcatctgtcgtaaatttatgtagtggtaat
gacagtacaatgtgcaataaggacgaggaaattttttactgttcaactgggccagagtct
gtacttcattcagtggataaagctgtcacagaggctgtccagcaaaacactaaaccagaa
aatgttgagctggatgaagctcagccagtcagtaaagagtctgacacaaatttgccagtc
aaatctgattcatcttgtcttcagtctgagaatccgccagagtcactacctaccgatgta
aaaaagggcagctgtagtacccgaaagtcacggtgggatattgttgggcaggattcctcg
gagagtgaaaattcacagagaactgtttgtgtagagagtaaactattaaatactgttaaa
aaggtgatctctgtcaaaaaaatagagttctctaaagataatgctcaacaagactgtgat
attaaagatgatattcagcaggaagctggaacacattccagactggtaaggcagacggag
atctcaaagcaggaagtccaatcagagagcacacccgtgacctttaattgcaaagaccaa
agtgagccttcgcaagccagcaccagcaatgaccactgtgactccaaactgtctgcttct
caaaagtcaaacacagatcagccactgcacataaatgacaagatacagatcaactcggca
gcaacagcacagcactcaaatgaggaaaattccgaaaacaaatccaaggacagtgctagc
aagagcaaactgagtaagagaatgtctcccagtcaggatgcgtcaggacagagtgaggcc
agtgatagcgataactcagagtatgactctgattgcgacgaggctataaaacagttgcac
tctgtagtagtggtgccaaagaattcttgtctaacaatgaatacagaggagaggggacct
ttgaatattttacaacagcagaatgccttagcagctgaaaaacatattagtgaaccccca
aatcaagttagccaacagaaaaaacaacccacaacacagaccggtataagcgattcactc
agtaatagtacattgtgtcagtcccagagcaatatgattgatagcaccagtcactcagag
gcctccacctccatcagtacccaaccttatactgctggtcataccagttcccatgcaagt
gtcacagattccacccccatgcgtgataattccaaacagtgtgagcaagggcacaaacaa
catgatgtgagcaacagaggagatcggacgcacgtgcattaccaacaagatcatttctcc
agggctgacaatattaatgagaagcatgaattcaacctgggttgggatttctcacaacca
gaacagcctactagtacgtaccagcagcctgatagcagccacgggcctcagttaacaaac
actaaactgtcaggatctttttccaaggaacaagaacacagaccaagtactgcttcctgt
atccagcagtcgcaaaacatgcagacaagcagaaaaaactacctccatgcaaatgtcatt
gatcaggatccttcaggcgaaattcaacccgactccctcactaatgatcatgacgacttc
agtggggataaatcatcaagttgtagcaaaacggcttttgagggcagtgggcctaacact
caagggtcatcaagctttgtacaaggtcatgaaataagcagcaatagcaggggttctgct
gtacccgacccctctagagaagacagttttaggccccacagaggaaggggccctcccaag
aaaaggcgtccagagatagagtccgattcagacaacgaggcagaggctggccctgcagct
aaaagggaccgtcaaggagatactgaagtcgctaaagaaactcttgtaaaatctgcagcg
gaccgtccatcactcactctgcaggactttcaagatgcaaatagatggaaagagtttgcc
aagtctaaaaagatgcctccgtactttgacttgattgaggagaacttgtacctaacagaa
aggaaaaaaagcaaatctcatcgagatattaaacgaatgcagtgtgagtgcccggtgcta
cccagagaggaccgagcaaggggcgtactagcatgcggagatgactgtttaaaccggctg
ctgatgattgagtgttcgtcacggtgcctgaatggagcctactgctctaatcgccgcttt
cagatgaaacaacatgccgactttgatgtgatccttacagaagacaagggctggggacta
cgggcagctaaagacttggcatcaaacacctttgtactggaatactgcggtgaggttttg
gaccacaaagagttcaaaacaagggtgaaagagtacgctcgcaataagaacatccactac
tattttatgtctctgaagaataacgagattattgatgcaacgctgaagggtaattgctct
cggttcatgaaccacagctgcgagcccaactgtgaaacccaaaagtggacagtcaacggt
cagcttcgagttgggttcttcaccaccaaggctgttactgcaggaactgagctcacgttt
gactaccagtttcagagatatgggaaagaagcacagaaatgcttctgtggagcacccagc
tgcagaggcttcctgggtggggagaacagagttagtgttcgagcagctggtgggaagatg
aagaaagaccgcagtcgaaagagtgctctcacaacggtcgatgaagagctggaggcatta
ctagagaatggcgaaggcttatacgatgagaaacaggtggtgtctctctgcagactgatg
gtccgagtggaaacgatggaacagaaactcatctgtctaaagctcatacaagatacacaa
aatccatcatgcttgaagcagttcttagaccaccatggattgtctttgctctggattttc
atggtggagctttccgaagctaaaggcaacagtgccaacaacatcaaactgcaattacag
atcatgaagaccctcagtgtgctgcccatctcaactaagaacatgttggaggagagcaga
gtcctgaccttcattcagcggtgggctcagacaaaaactcttcctcagcagactgagatg
gatggttactctagtgagaacacctcccgtgcccaaactcccctcaacactcctgatggt
tcctccgctaaaatgggaccagaactagatagtgacacgtccaagcctgctgtgtacaga
cgccttaaaatcattagcgaaaacagtctggacagcgctctttctgatgctagcaaagca
tccgatgggaaagaggaagaggaggaggaggatgatgaggaagatgatgaaaattcacgt
gcaggacttcctgaaggaaagcagttgaagccagacacaccggtggacgctgcagatcca
accacagattcagtggaagagtcgggaaaagaagtcataggagagaaacaggaagaggca
gcgatgacttcaagcagtgaacctcaacctccaactgaagaggtgaaggaaaaacctgat
ttggttgtggaagaggactccgatataaaagaagtcaaaagtgaagatcaggcagatgag
ctggaaccagcaaaagagccagttgaaacacaagagagtgggaagcctcaagataaccaa
tcagtgacagaaaatgcagaattagaagaaggccagcccagtgttaaagtccatgagcca
gagacccaatccagtcaaacgggtgttgctgatgctccacctgagcagccttcagagact
atggaatcccagacagaggctgaagaggctaagaaaacactgcctagcagtgagccacac
agtggtgaaccaaccactgatgttccacctatcgctgaagccccggaggccacgattccc
tcagcggtcacagcaacccctgtggatccatcagtgatagggacgccttctcaagatgaa
gaggaaggtgtctcagatgtggagagtgagaggagtcaggaaccacagctcagtgttttc
gacattagtggcatggctgctaggcttctagaaagctggaaggatctaaaggaggtgtac
aggataccaaagaagactcaagtagataaggaaggaagagatcgcagccgagatcgagat
acatctttcacgccacgcaccacgtcaggaagccgagaacgtgagcgagagaaggagagg
gaacgggacagggatcgagattgggacagagacagggatcgagattgggacagagacagg
gatcgagattgggacagagacagggaccgcgatcgaggctctgagaaaactccgcgcagc
tctgagcgacggaggagacgctcgccatctccaccttcatcctacgagaggagcagccga
cgcactgaggaacggtttgatccatctaacagcagcaagacaccaagaggagttggtggc
aaggagcgcaacaaactgtccacagaggagcgcaggaagctgtttgaacaggaggttgcc
cagcgggaagcacagaagcagcaacagcttcaacagcagcagcagctccagtctttggct
tatgacccggctctagcctatgcctccagccctggtttcatcacgtacccacctggatat
cccatccagacttttgtggatccttccaaccccaatgcgggcaaagtacttctcccaaca
cctacagtggagccgagtctcaactatgaacagactccaccccagcgtctcgtctcagat
ctaggactgacctctccatcttccactccccaaaccactccagtcaccaatctccctcag
cacgtcactaccgcaaaccttgcctctggcaaccctcagcactatgcccagccaactgta
gcaacccaggatgcaggcgtagctgtcctgtcggtaccagcccagtctgcccctcaggta
cagggccaacagagctacaccactctctgggaccccaccactcagcaggcagtgactgtg
cagacacaacctgcacagcagtatgccacagccccgggacagggtcagactcccacagct
atctattatcagggccagccttgccaaacaatctacagcatccctgctccctacccccag
accaacactccagtcatacaggcatacactgatcccacagccagctacctacatggccag
ccggtatatcctggtcagcagggagtggtggtgcagcagggaggcacagtcaccaccatt
gtaacatctcaaactgttcagcaggaaatgattgtccccaacagtgtgatagacctgcct
ccaccttctccccctaaacccaaaactatcgtcctacctcccaactggaaagtggctcgg
gaccctgaaggcaaaatttactactaccatattgttacaaggcaaacacagtgggatcca
ccaacctgggaaggaaatagtgacaacactagtgtggaccatgaatcagagatggacctg
ggaacacccacctatgatgaaaatccttccaaattttccacaaagacggctgaagcagac
acttccagtgaactcgctaagaaaagtaaagagacctttcgcaaggagatgtcacagttc
atagtgcaatgcttgaatccttatcgaaagccagactgcaaatctggacgcatcagcaac
acagaagacttcaaacacctggctagaaagctaactcacggagttatgaataaggagttg
aaagcttgcaagaatcccgaggacctcgagtgcaatgaaaatgtgaagcacaagaccaag
gaatacatcaaaaagtacatgcagcgattcggcgccgtgtacagacccaaggaggacaca
gaggtgtattga

DBGET integrated database retrieval system