KEGG   Maylandia zebra (zebra mbuna): 101475727Help
Entry
101475727         CDS       T02814                                 

Gene name
suv39h1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101475727 (suv39h1)
Enzymes [BR:mze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101475727 (suv39h1)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101475727 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101475727 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MAENLKDCSVPCKMSWDELEAMCRMEKLQCQELGVSRANVNEYEVEFLCDYKKTKEEELY
LVKWKGFPESDNTWEPKRNLKCPKLMKQFHLDLDQELRRHKRRCIPKKLDKEVSSFLVQK
AKLRQSLQRWEDHLNHTRNHPGRIFVMNEVDLEGPPKNFTYINNYKVGQGIVLDEMAVGC
ECKNCLEEPVNGCCPGASLQRMAYNDRGQVRIRPGQPIYECNSRCSCGPDCPNRVVQNGI
QFDLCIFKTGNGRGWGVRTLQHIKRNTFVMEYIGEIITTDEAERRGHIYDRQGSTYLFDL
DYVEDVYTVDAAHLGNISHFVNHSCNPNLQVYNVFIDNIDERLPRIALFSTRAIRAGEEL
TFDYKMQIDPVDTESTKMDSSFSLAGLPGSPKKRVRVECRCGSDSCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttgaaagattgcagcgtgccctgcaagatgtcctgggatgagctggaa
gccatgtgtcgaatggagaaactccagtgtcaagagcttggagttagcagagccaacgtc
aatgaatacgaggttgaattcctatgtgactacaagaagactaaggaagaggagttgtac
cttgtaaaatggaagggctttccagaatcagataacacttgggaacccaagaggaaccta
aaatgtcccaaactgatgaagcagttccatcttgacttggaccaggagctgaggcgccac
aagcgacgttgcatcccaaaaaagctagataaagaagtttcctcatttctggtccaaaaa
gccaaacttcgccagagtctgcagcgctgggaagaccatctgaatcatactcgcaatcat
ccagggcgcatttttgtcatgaacgaagtggacctagagggtcctccgaaaaactttacc
tatatcaacaactataaagtaggtcagggcattgtgttagatgagatggcagtgggttgt
gaatgcaaaaactgtttagaggagccagtgaatggctgttgccctggggcttccctccaa
cgcatggcctacaacgacagaggacaggtccggattcggcctggacagccaatatatgag
tgcaactcccgctgcagctgtgggcctgactgtcccaacagagttgtgcagaatggcatc
cagttcgatctgtgtatctttaaaacggggaacggccggggatggggagtccgcacactg
cagcacatcaagaggaacacatttgtcatggagtacattggggagattatcaccacagac
gaagcagagagaagaggtcatatatatgatcgccagggctctacgtacctctttgacctg
gactatgtcgaggacgtgtacacagtggatgcagctcacctaggcaacatttctcatttt
gtcaaccacagctgtaaccctaacctgcaggtatacaacgtgttcattgacaacattgac
gaaaggcttccgagaattgcgttattttcaacacgtgctatccgagcaggagaggagctc
acctttgactacaaaatgcaaattgatccagttgatacagaaagcaccaaaatggattcc
agtttcagtctagctgggcttcctggctctccaaagaagagggttcgagtggagtgtcgg
tgtggatcagactcatgtcgaaaatatctgttctga

DBGET integrated database retrieval system