KEGG   Maylandia zebra (zebra mbuna): 101483426Help
Entry
101483426         CDS       T02814                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101483426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 784 aa AA seqDB search
MPGERLTVRTTSEIGRFPGAAPPTRVELTIQNEGEKKREEGGCLWWLRKMCPCCCKHPNA
TSYDVTDKVEFTKLPTPAAIVDPPKPKPENGEAKETDEGKLSVCSVDLLSSKAGQNRQEH
HTDLYHRDELILRRGQTFQIEVELNRPFSTDTDKLYLELKTGSLPLVSKGTHVIIPLVKH
LEDERWEAKIVEQNGNKIKLSINSPANAVIGLYELTVTTSSLKGDATTTYTSSKNIVMLF
NPWCEEDSVFLDNEEERKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGILEACLFIMEK
SEMPPSGRGDPVNVVRVISAMINAQDDYGVLVGNWSGDYSDGVSPTAWSSSVEILRKYHS
TNGTPVSYGQCWVFSGITTTVLRCLGIPSRSVTNFQSAHDTDVSLTTDVYLNENLEPIDY
LNRDSVWNFHVWNDCWMARPDLPPGNGGWQAVDATPQETSQGTFRCGPASVNAIRSGHVY
LKHDTPFVFAEVNSDKIYWQRNLDGTFKQIYSEKKAVGHCISTKAVGSDKRADITSLYKH
EEDSEEERIAVETASRYGSKPDVYSTPVAEDVSVEVKVDGEGPRVGADAQLKILVKNLSS
QPRQATIHSQVAVMYYTGVLKGTIKKEQMPVELSPNEEKTIDWVLPYQQYQSQLVDQAAF
MLTLCGRVTETKQVLANQTTFRLRTPDITITPIGDAVVGKEMAAKITFTNPLPSTLKGVV
FRVEGLGLQEGHEVVVGDVGAHSKVTLTEHFIPSQPGPRKLVASLDCEQLSQVHGVADIV
VLEQ
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgagcggttaacagtaagaactacatcagagattgggcgattccccggagca
gccccacccacaagggtggagctgaccatccagaatgagggtgagaagaagcgggaggag
gggggctgtctatggtggctcagaaagatgtgcccgtgctgctgtaagcacccaaacgcc
acctcatatgatgtcacagataaggtggaattcaccaaactcccaacccctgccgccatc
gtagatccccccaagccgaagcccgagaacggagaggcaaaggaaacagatgaagggaag
ctgtcagtgtgttcggtggacctattgagttccaaggcaggtcagaacagacaggagcat
cacactgacctgtatcaccgggatgagctgatccttcgcagaggccagaccttccagata
gaggttgagctcaacaggcccttcagtactgacactgacaagctgtacctggagctgaaa
acaggttccctgcccttggtatccaaagggacccatgtcatcattccgctggtgaagcac
ctggaagatgaacgctgggaggccaaaattgtagagcagaacggcaataagatcaagctg
tccatcaactctccagccaacgctgtgatcggcctttacgagctcactgtgacaacttct
tcgctcaaaggcgacgccacaactacttacacctccagcaagaacattgtcatgctcttc
aacccttggtgtgaagaggacagcgtgttcctggataacgaggaggagaggaaggagtat
gtgctgaatgacactgggaggatttactacggaacggagaaacaaatcggtgctcgcacg
tggaatttcggacagtttcatgagggaatcctggaagcatgtctgtttatcatggagaag
agtgaaatgccgccatctggtcgaggggatccggtcaacgtggtcagggtcatatctgcc
atgataaatgctcaggatgactacggtgttctagttggaaactggtcaggtgattactct
gatggagtctcacctacggcgtggagcagcagcgtggagatcctgaggaaataccactcg
accaatggaacgcctgtgtcatatggacagtgctgggtcttctctgggatcactacaaca
gtgctgcgctgccttggcattccttcccgcagtgtgaccaacttccagtcagcacatgat
accgacgtatcccttactacagatgtataccttaatgagaatttggagccaattgactat
ctcaatagagactctgtttggaatttccacgtatggaatgactgctggatggccagacca
gacttacctccaggtaatggaggctggcaggccgtagacgccactccccaggaaactagc
cagggcaccttccgctgtggccctgcttctgtgaacgccatccgctctggccatgtctac
cttaaacatgacacgccgtttgtctttgctgaggtcaacagtgacaaaatttactggcag
agaaacctggacggcacatttaaacagatctacagtgaaaagaaagctgtcggccactgc
atcagcaccaaagcggtgggctctgataagcgggcagatatcacatccttgtacaaacat
gaagaagattcagaagaagaacgcattgcagtagagactgcaagtcgctatggcagcaag
ccagatgtctattccacaccagtggcagaagatgtgtcagtggaggtaaaggtggatggc
gagggacccagggtgggtgctgatgcccagttgaaaattctggtgaagaatctaagctca
cagccccgccaggcaacaatccacagccaggtggctgtcatgtactacactggagtgctg
aagggaaccatcaagaaggagcagatgcctgtggagctttcgcctaatgaagagaaaacc
attgactgggtcctgccctaccaacaataccagagccagctggtggatcaagcagccttc
atgctaaccctgtgtggaagagtcactgaaacgaagcaagtgctagctaaccagacaact
ttcaggcttcgcacacctgacatcaccatcacacctattggagacgccgttgttggtaaa
gagatggctgccaagattactttcaccaaccccctgccatctacactgaagggagtggtg
ttcagagtggagggcctgggccttcaggagggccatgaggtggtcgtgggtgacgtcggc
gcccactccaaagtgacgctgacagagcacttcatcccctcccaacctggacccaggaag
ctggtggcgtccctcgactgtgaacagctctcacaagtgcatggagtggctgacattgtt
gttcttgaacaatga

DBGET integrated database retrieval system